Flow stage update by cuff on 20 Nov 2008 15:50
nice chopping
PDB Chain: 3by5A
3by5A
PDB 3by5, Chain A
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 3by5A00 | 3.30.420.180 |
Chain ATOM Sequence
>pdb|3by5A VTVAGIGCRKGAASDAIIAAVRAAERAFGVTVDYLATAPLKADEAGLAEAAKGLSLSLEIVAQERLEAVAAETTFSQASL DHSGSPSVSEAAALAAAGAGARLVAPRLVVGDVTVAIATSD
Chain History Events (49)
Chain chopped by cuff on 20 Nov 2008 15:50
nice chopping
Domchop review by garner on 10 Jun 2008 10:21
Single domain protein
Flow stage update by garner on 10 Jun 2008 10:21
Single domain protein
Domchop allotment by garner on 10 Jun 2008 10:20
User 'garner' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by garner on 10 Jun 2008 10:20
User 'garner' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 01 Feb 2008 05:14
HMM(SAM) job SID1213769805151536 for entry "3by5A" returned no results. This is not uncommon for chain SAM scans so the chain is being moved on.
Update comment by auto on 01 Feb 2008 02:39
HMM(SAM) job SID1213769805151536 is not yet finished.
Hmm submit by auto on 01 Feb 2008 02:36
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 01 Feb 2008 02:36
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 31 Jan 2008 23:08
Unable to retrieve "3by5A" HMM(SAM) results for job "SID9059592206948504"
Update comment by auto on 30 Jan 2008 02:15
HMM(SAM) job SID9059592206948504 is not yet finished.
Hmm submit by auto on 30 Jan 2008 02:12
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 30 Jan 2008 02:12
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 29 Jan 2008 23:10
Unable to retrieve "3by5A" HMM(SAM) results for job "SID0931440505015832"
Update comment by auto on 29 Jan 2008 02:16
HMM(SAM) job SID0931440505015832 is not yet finished.
Flow stage update by auto on 29 Jan 2008 02:12
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Hmm submit by auto on 29 Jan 2008 02:12
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Jan 2008 23:07
Unable to retrieve "3by5A" HMM(SAM) results for job "SID5243882128120458"
Update comment by auto on 28 Jan 2008 14:09
HMM(SAM) job SID5243882128120458 is not yet finished.
Hmm submit by auto on 28 Jan 2008 14:07
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Jan 2008 14:07
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Jan 2008 08:08
Unable to retrieve "3by5A" HMM(SAM) results for job "SID9815630360656224"
Update comment by auto on 28 Jan 2008 02:18
HMM(SAM) job SID9815630360656224 is not yet finished.
Hmm submit by auto on 28 Jan 2008 02:15
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Jan 2008 02:15
The entry "3by5A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 28 Jan 2008 02:13
Retrieved "3by5A" CATHEDRAL results for job ID SID4798999062112144 and inserted them into the database.
Chain chopping cathedral by auto on 28 Jan 2008 02:13
Chain "3by5A" CATHEDRAL chopping from job SID4798999062112144
Update comment by auto on 27 Jan 2008 14:19
"3by5A" CATHEDRAL job SID4798999062112144 is not yet finished.
Cathedral submit by auto on 27 Jan 2008 14:16
The entry "3by5A" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2008 14:16
The entry "3by5A" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 27 Jan 2008 14:12
ScanList with 11665 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3by5A.scanlist" for "3by5A"
Update comment by auto on 27 Jan 2008 02:29
Waiting for 54 new domains (example : 2vllA02) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jan 2008 20:07
Waiting for 158 new domains (example : 2r3gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jan 2008 14:09
Waiting for 201 new domains (example : 2jivA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Jan 2008 01:48
Waiting for 217 new domains (example : 2e86A01) to be processed so that they can be scanned against too.
Chain chopping puu by auto on 26 Jan 2008 01:48
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 26 Jan 2008 01:48
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "3by5A"
Chain chopping domak by auto on 26 Jan 2008 01:48
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Chain chopping detective by auto on 26 Jan 2008 01:48
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Flow stage update by auto on 26 Jan 2008 01:27
Number of chains in ballcock flow stages is 78 which is less than the max allowed of 800
Flow stage update by auto on 25 Jan 2008 23:09
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 25 Jan 2008 23:09
Putative ChopClose added based on similarity with "2hz2A"
Flow stage update by auto on 25 Jan 2008 22:57
No in_process hits for Chain "3by5A" ready to be processed
Flow stage update by auto on 25 Jan 2008 22:57
NW result present for Chain "3by5A"
Flow stage update by auto on 25 Jan 2008 07:57
All required files are present for Chain "3by5A"
Flow stage update by auto on 24 Jan 2008 22:57
Beginning processing for Chain "3by5A"
Flow stage update by auto on 24 Jan 2008 19:51
Chain passed the SIFT criteria
Insertion by auto on 24 Jan 2008 19:51
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
