Flow stage update by cuff on 20 Oct 2008 16:52
nice chopping
PDB Chain: 3beeA
3beeA
PDB 3bee, Chain A
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 3beeA00 | 1.25.40.10 |
Chain ATOM Sequence
>pdb|3beeA NAVTATQLAAKATTLYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTI IESINKAKKL
Chain History Events (32)
Chain chopped by cuff on 20 Oct 2008 16:52
nice chopping
Domchop allotment by tronnberg on 10 Dec 2007 09:33
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 10 Dec 2007 09:33
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 09 Dec 2007 06:06
HMM(SAM) job SID4009771020672256 for entry "3beeA" returned no results. This is not uncommon for chain SAM scans so the chain is being moved on.
Update comment by auto on 09 Dec 2007 02:19
HMM(SAM) job SID4009771020672256 is not yet finished.
Hmm submit by auto on 09 Dec 2007 02:17
The entry "3beeA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 09 Dec 2007 02:17
The entry "3beeA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 09 Dec 2007 02:13
Retrieved "3beeA" CATHEDRAL results for job ID SID5741388601214192 and inserted them into the database.
Chain chopping cathedral by auto on 09 Dec 2007 02:13
Chain "3beeA" CATHEDRAL chopping from job SID5741388601214192
Update comment by auto on 08 Dec 2007 22:13
"3beeA" CATHEDRAL job SID5741388601214192 is not yet finished.
Flow stage update by auto on 08 Dec 2007 22:11
The entry "3beeA" has been submitted to the CATHEDRAL webservice.
Cathedral submit by auto on 08 Dec 2007 22:11
The entry "3beeA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 08 Dec 2007 22:08
ScanList with 11651 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA.scanlist" for "3beeA"
Update comment by auto on 08 Dec 2007 18:03
Waiting for 30 new domains (example : 2za1B00) to be processed so that they can be scanned against too.
Update comment by auto on 08 Dec 2007 02:27
Waiting for 96 new domains (example : 2dxmA00) to be processed so that they can be scanned against too.
Update comment by auto on 07 Dec 2007 22:05
Waiting for 90 new domains (example : 2dxmA00) to be processed so that they can be scanned against too.
Update comment by auto on 07 Dec 2007 18:50
Waiting for 88 new domains (example : 2dxmA00) to be processed so that they can be scanned against too.
Chain chopping puu by auto on 07 Dec 2007 18:50
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 07 Dec 2007 18:50
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_PUU) for Chain "3beeA"
Chain chopping detective by auto on 07 Dec 2007 18:50
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Flow stage update by auto on 07 Dec 2007 18:48
Number of chains in ballcock flow stages is 22 which is less than the max allowed of 800
Flow stage update by auto on 07 Dec 2007 18:26
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 07 Dec 2007 18:26
Putative ChopClose added based on similarity with "1u84A"
Flow stage update by auto on 07 Dec 2007 17:57
No in_process hits for Chain "3beeA" ready to be processed
Flow stage update by auto on 07 Dec 2007 17:57
NW result present for Chain "3beeA"
Flow stage update by auto on 07 Dec 2007 05:57
All required files are present for Chain "3beeA"
Flow stage update by auto on 06 Dec 2007 17:57
Beginning processing for Chain "3beeA"
Flow stage update by auto on 06 Dec 2007 17:09
Chain passed the SIFT criteria
Insertion by auto on 06 Dec 2007 17:09
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
