Flow stage update by cuff on 19 Nov 2008 17:35
nice chopping
PDB Chain: 3bbyA
3bbyA
PDB 3bby, Chain A
CATH Domains (2)
| Domain ID | CATH code | Image |
|---|---|---|
| 3bbyA01 | Not yet assigned | |
| 3bbyA02 | 1.20.1050.10 |
Chain ATOM Sequence
>pdb|3bbyA KPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDRVPLLQIDDFELSESSAIAEYLEDRFAPPTWERIYPLDLENRA RARQIQAWLRSDLPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAAEHLLVLGQPNLFGEWCIADTDLALINRLVLHGD EVPERLVDYATFQWQRASVQRFIALSAK
Chain History Events (60)
Chain chopped by cuff on 19 Nov 2008 17:35
nice chopping
Chain chopping manual by tronnberg on 04 Dec 2007 14:38
Two domains, AMA. SSAP score: ~80
Domchop review by tronnberg on 04 Dec 2007 14:38
Two domains, AMA. SSAP score: ~80
Flow stage update by tronnberg on 04 Dec 2007 14:38
Two domains, AMA. SSAP score: ~80
Domchop allotment by tronnberg on 04 Dec 2007 14:37
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 04 Dec 2007 14:37
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 30 Nov 2007 10:15
Retrieved HMM(SAM) results for job ID SID7800192055274508 and inserted them into the database.
Chain chopping hmm by auto on 30 Nov 2007 10:15
Chain HMM chopping
Update comment by auto on 29 Nov 2007 21:52
HMM(SAM) job SID7800192055274508 is not yet finished.
Hmm submit by auto on 29 Nov 2007 20:59
The entry "3bbyA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 29 Nov 2007 20:59
The entry "3bbyA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 29 Nov 2007 19:50
Retrieved "3bbyA" CATHEDRAL results for job ID SID4131604165123268 and inserted them into the database.
Chain chopping cathedral by auto on 29 Nov 2007 19:50
Chain "3bbyA" CATHEDRAL chopping from job SID4131604165123268
Cathedral submit by auto on 29 Nov 2007 15:18
The entry "3bbyA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 29 Nov 2007 15:18
The entry "3bbyA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 29 Nov 2007 13:57
ScanList with 11621 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bbyA.scanlist" for "3bbyA"
Update comment by auto on 29 Nov 2007 10:15
Waiting for 1594 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 06:19
Waiting for 1671 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 02:20
Waiting for 1745 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 22:13
Waiting for 1813 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 18:12
Waiting for 1925 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 14:12
Waiting for 2025 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 10:12
Waiting for 2103 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 06:13
Waiting for 2165 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 02:24
Waiting for 2241 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 22:13
Waiting for 2310 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 18:13
Waiting for 2395 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 14:16
Waiting for 2481 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 10:15
Waiting for 2560 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 06:23
Waiting for 2626 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 02:25
Waiting for 2696 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 22:15
Waiting for 2762 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 18:16
Waiting for 2842 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 14:16
Waiting for 2927 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 10:16
Waiting for 3009 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 06:23
Waiting for 3066 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 02:27
Waiting for 3137 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 22:17
Waiting for 3212 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 18:19
Waiting for 3283 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 14:27
Waiting for 3356 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 10:19
Waiting for 3439 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 06:33
Waiting for 3490 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 02:30
Waiting for 3566 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 22:19
Waiting for 3616 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 19:48
Waiting for 3703 new domains (example : 2dzoC00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 14:37
Waiting for 3547 new domains (example : 1dwlA00) to be processed so that they can be scanned against too.
Chain chopping detective by auto on 24 Nov 2007 14:17
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping puu by auto on 24 Nov 2007 14:17
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 24 Nov 2007 14:17
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "3bbyA"
Chain chopping domak by auto on 24 Nov 2007 14:17
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 24 Nov 2007 14:14
Number of chains in ballcock flow stages is 676 which is less than the max allowed of 800
Flow stage update by auto on 24 Nov 2007 14:14
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 24 Nov 2007 14:14
Putative ChopClose added based on similarity with "1aw9A"
Flow stage update by auto on 24 Nov 2007 13:57
No in_process hits for Chain "3bbyA" ready to be processed
Flow stage update by auto on 24 Nov 2007 13:57
NW result present for Chain "3bbyA"
Flow stage update by auto on 24 Nov 2007 13:57
All required files are present for Chain "3bbyA"
Flow stage update by auto on 22 Nov 2007 21:57
Beginning processing for Chain "3bbyA"
Flow stage update by auto on 22 Nov 2007 18:32
Chain passed the SIFT criteria
Insertion by auto on 22 Nov 2007 18:32
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
