PDB Chain: 2r2cB

Molscript image for 2r2cB
2r2cB
PDB coordinates for chain 2r2cB

PDB 2r2c, Chain B

CATH Domains (1)

Domain IDCATH codeImage
2r2cB00 2.60.40.320 Molscript image for 2r2cB00

[top]
Domain boundaries for PDB chain 2r2cB

Chopping figure for chain 2r2cB
Domain IDStart ResStop Res NameLength
2r2cB00 53 180 107

[top]
Chain ATOM Sequence 

>pdb|2r2cB
AKINIFAVAEYTDTQKIKVTVKGKILEGNTLPKSVQVYLLEDHVLRGAVNGIWGEEFVNLKDYLYTYAVEPLSGSFVAEN
YSIVAFVYDVQTFEVYDVVHVKINPQS
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2r2cB
AKINIFAVAEYTDTQKIKVTVKGKILEGNTLPKSXVQVYLLEDKLIAPQVDGNTTVENYEHNHVLRGAVNGIWGEEFVNL
KDYLYTYAVEPLSGXSFVAENYSIVAFVYDVQTFEVYDVVHVKINPQSDGK
BLAST against CATH

[top]
Chain History Events (12)

Flow stage update by auto on 22 Sep 2008 14:04

Final ChopClose added based on similarity with "2r2cA"

Chain chopped by auto on 22 Sep 2008 14:04

Final ChopClose added based on similarity with "2r2cA"

Chain chopping chopclose by auto on 22 Sep 2008 14:04

Putative ChopClose added based on similarity with "2r2cA"

Flow stage update by auto on 22 Sep 2008 13:57

No in_process hits for Chain "2r2cB" ready to be processed

Update comment by auto on 23 Jul 2008 17:42

Chain "2r2cB" hits Chain "2r2cA" (98.4732824427481% over 88.5135135135135%) which is currently in process

Update comment by auto on 23 Nov 2007 10:08

Chain "2r2cB" hits Chain "2r2cA" (98.4732824427481% over 88.5135135135135%) which is currently in process

Flow stage update by auto on 23 Nov 2007 10:02

Chain "2r2cB" hits Chain "2r2cA" (98.4732824427481% over 88.5135135135135%) which is currently in process

Flow stage update by auto on 23 Nov 2007 10:00

NW result present for Chain "2r2cB"

Flow stage update by auto on 23 Nov 2007 09:59

All required files are present for Chain "2r2cB"

Flow stage update by auto on 12 Nov 2007 18:42

Beginning processing for Chain "2r2cB"

Flow stage update by auto on 08 Nov 2007 03:26

Chain passed the SIFT criteria

Insertion by auto on 08 Nov 2007 03:21

Adding chain from chain pdb dir "/cath/data/current/chainpdb"