Flow stage update by cuff on 10 Sep 2008 14:59
nice chopping
PDB Chain: 2qt3A
2qt3A
PDB 2qt3, Chain A
CATH Domains (2)
| Domain ID | CATH code | Image |
|---|---|---|
| 2qt3A01 | 2.30.40.10 | |
| 2qt3A02 | 3.20.20.140 |
Chain ATOM Sequence
>pdb|2qt3A KDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSRPY TRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQSG FFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENGYK GRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGAL IETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEVIV A
Chain COMBS Sequence
>pdb|2qt3A MSKDFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAKIEGTVKDEIDAKGNLVSPGFVDAHTHMDKSFTSTGERLPKFWSR PYTRDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVAKTKAVEAVLEAKEELKDLIDIQVVAFAQ SGFFVDLESESLIRKSLDMGCDLVGGVDPATRENNVEGSLDLCFKLAKEYDVDIDYHIHDIGTVGVYSINRLAQKTIENG YKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSSTPPTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQG ALIETQRLELKTNRDLGLIWKMITSEGARVLGIEKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDEV IVA
Chain History Events (61)
Chain chopped by cuff on 10 Sep 2008 14:59
nice chopping
Domchop review by tronnberg on 04 Dec 2007 09:39
Two domains, AMA. SSAP score: 89
Flow stage update by tronnberg on 04 Dec 2007 09:39
Two domains, AMA. SSAP score: 89
Domchop allotment by tronnberg on 04 Dec 2007 09:38
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 04 Dec 2007 09:38
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by auto on 30 Nov 2007 04:48
Retrieved HMM(SAM) results for job ID SID6754466592102457 and inserted them into the database.
Chain chopping hmm by auto on 30 Nov 2007 04:47
Chain HMM chopping
Update comment by auto on 29 Nov 2007 21:40
HMM(SAM) job SID6754466592102457 is not yet finished.
Hmm submit by auto on 29 Nov 2007 20:40
The entry "2qt3A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 29 Nov 2007 20:40
The entry "2qt3A" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 29 Nov 2007 19:27
Retrieved "2qt3A" CATHEDRAL results for job ID SID3865927326604928 and inserted them into the database.
Chain chopping cathedral by auto on 29 Nov 2007 19:27
Chain "2qt3A" CATHEDRAL chopping from job SID3865927326604928
Cathedral submit by auto on 29 Nov 2007 14:56
The entry "2qt3A" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 29 Nov 2007 14:56
The entry "2qt3A" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 29 Nov 2007 13:16
ScanList with 11621 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2qt3A.scanlist" for "2qt3A"
Update comment by auto on 29 Nov 2007 10:13
Waiting for 1594 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 06:16
Waiting for 1671 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 29 Nov 2007 02:16
Waiting for 1745 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 22:11
Waiting for 1813 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 18:09
Waiting for 1925 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 14:10
Waiting for 2025 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 10:10
Waiting for 2103 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 06:10
Waiting for 2165 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 28 Nov 2007 02:19
Waiting for 2241 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 22:10
Waiting for 2310 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 18:10
Waiting for 2395 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 14:12
Waiting for 2481 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 10:11
Waiting for 2560 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 06:18
Waiting for 2626 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 27 Nov 2007 02:19
Waiting for 2696 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 22:11
Waiting for 2762 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 18:12
Waiting for 2842 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 14:12
Waiting for 2927 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 10:12
Waiting for 3009 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 06:18
Waiting for 3066 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 26 Nov 2007 02:21
Waiting for 3137 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 22:12
Waiting for 3212 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 18:14
Waiting for 3283 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 14:20
Waiting for 3356 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 10:14
Waiting for 3439 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 06:27
Waiting for 3490 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 25 Nov 2007 02:23
Waiting for 3566 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 22:14
Waiting for 3616 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 19:43
Waiting for 3703 new domains (example : 2dzoC00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 14:32
Waiting for 3547 new domains (example : 1dwlA00) to be processed so that they can be scanned against too.
Update comment by auto on 24 Nov 2007 02:30
Waiting for 3471 new domains (example : 1dwlA00) to be processed so that they can be scanned against too.
Update comment by auto on 23 Nov 2007 13:57
Waiting for 2842 new domains (example : 1a3qA01) to be processed so that they can be scanned against too.
Chain chopping puu by auto on 23 Nov 2007 13:27
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 23 Nov 2007 13:27
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "2qt3A"
Chain chopping detective by auto on 23 Nov 2007 13:27
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping domak by auto on 23 Nov 2007 13:27
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 23 Nov 2007 12:38
Number of chains in ballcock flow stages is 476 which is less than the max allowed of 800
Flow stage update by auto on 23 Nov 2007 12:02
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 23 Nov 2007 12:02
Putative ChopClose added based on similarity with "1k6wA"
Flow stage update by auto on 23 Nov 2007 10:02
No in_process hits for Chain "2qt3A" ready to be processed
Flow stage update by auto on 23 Nov 2007 10:00
NW result present for Chain "2qt3A"
Flow stage update by auto on 23 Nov 2007 09:59
All required files are present for Chain "2qt3A"
Flow stage update by auto on 12 Nov 2007 18:42
Beginning processing for Chain "2qt3A"
Flow stage update by auto on 08 Nov 2007 03:26
Chain passed the SIFT criteria
Insertion by auto on 08 Nov 2007 03:20
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
