Flow stage update by auto on 17 Aug 2007 02:13
Final ChopClose added based on similarity with "2ax5A"
| Domain ID | CATH code | Image |
|---|---|---|
| 2qjlA00 | 3.10.20.30 |
>pdb|2qjlA MVNVKVEFLGGLDAIFGKQRVHKIKMDKEDPVTVGDLIDHIVSTMINNPNDVSIFIEDDSIRPGIITLINDTDWELEGEK DYILEDGDIISFTSTLHGG
Final ChopClose added based on similarity with "2ax5A"
Final ChopClose added based on similarity with "2ax5A"
Putative ChopClose added based on similarity with "2ax5A"
No in_process hits for Chain "2qjlA" ready to be processed
NW result present for Chain "2qjlA"
All required files are present for Chain "2qjlA"
Beginning processing for Chain "2qjlA"
This chain has previously been marked as rejected by SIFT but is passes the SIFT criteria and so is being moved to NEW for processing.
Updated the chain's properties [modified "atom_md5_code" from "" to "8ffd900ffed137c3cc53a4a1007fbc71"] [modified "combs_md5_code" from "" to "8ffd900ffed137c3cc53a4a1007fbc71"] [modified "seqres_md5_code" from "" to "8ffd900ffed137c3cc53a4a1007fbc71"] [modified "seq_length" from undef to "99"]
Chain was not imported from a cathlist and failed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/current/chainpdb"