PDB Chain: 2hufA

Molscript image for 2hufA
2hufA
PDB coordinates for chain 2hufA

PDB 2huf, Chain A

CATH Domains (2)

Domain IDCATH codeImage
2hufA01 3.90.1150.10 Molscript image for 2hufA01
2hufA02 3.40.640.10 Molscript image for 2hufA02

[top]
Domain boundaries for PDB chain 2hufA

Chopping figure for chain 2hufA
Domain IDStart ResStop Res NameLength
2hufA01 1 30 30
2hufA01 280 385 106
2hufA02 31 279 248

[top]
Chain ATOM Sequence 

>pdb|2hufA
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAPQRVLDAMSRPILGHLHPETLKIMDDIKEGVRYLFQTNNIATFCLSASGH
GGMEATLCNLLEDGDVILIGHTGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVL
QGLEGVGALCHQHNCLLIVDTVASLGGAPMFMDRWEIDAMYTGSQVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWDM
SLVGDYWGCFGRPRIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIK
VPQGVDWLKAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKP
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2hufA
MEYKVTPPAVLREPLVTPNKLLMGPGPSNAPQRVLDAMSRPILGHLHPETLKIMDDIKEGVRYLFQTNNIATFCLSASGH
GGMEATLCNLLEDGDVILIGHTGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVL
QGLEGVGALCHQHNCLLIVDTVASLGGAPMFMDRWEIDAMYTGSQXVLGAPPGITPVSFSHRAVERYKRRNTKVKVYYWD
MSLVGDYWGCFGRPRIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTI
KVPQGVDWLKAAQYAMKTYLVEISGGLGPTAGQVFRIGLMGQNATTERVDRVLQVFQEAVAAVKPDVQVKGKM
BLAST against CATH

[top]
Chain History Events (20)

Flow stage update by auto on 15 Jul 2007 18:21

Final ChopClose added based on similarity with "2hufB"

Chain chopped by auto on 15 Jul 2007 18:21

Final ChopClose added based on similarity with "2hufB"

Chain chopping chopclose by auto on 15 Jul 2007 18:21

Putative ChopClose added based on similarity with "2hufB"

Flow stage update by auto on 15 Jul 2007 18:10

No in_process hits for Chain "2hufA" ready to be processed

Update comment by auto on 15 Jul 2007 14:08

Chain "2hufA" hits Chain "2huiB" (99.7455470737913% over 100%) which is currently in process

Update comment by auto on 15 Jul 2007 10:04

Chain "2hufA" hits Chain "2hufB" (99.7455470737913% over 100%) which is currently in process

Update comment by auto on 15 Jul 2007 06:07

Chain "2hufA" hits Chain "2ch1D" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 15 Jul 2007 02:09

Chain "2hufA" hits Chain "2ch1B" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 14 Jul 2007 22:05

Chain "2hufA" hits Chain "2ch1A" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 14 Jul 2007 20:05

Chain "2hufA" hits Chain "2ch2A" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 14 Jul 2007 16:08

Chain "2hufA" hits Chain "2ch1C" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 14 Jul 2007 10:08

Chain "2hufA" hits Chain "2ch2D" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 14 Jul 2007 04:06

Chain "2hufA" hits Chain "2ch2C" (51.1450381679389% over 98.989898989899%) which is currently in process

Update comment by auto on 12 Jul 2007 20:57

Chain "2hufA" hits Chain "2ch2B" (51.1450381679389% over 98.989898989899%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:48

Chain "2hufA" hits Chain "2ch2B" (51.1450381679389% over 98.989898989899%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2hufA"

Flow stage update by auto on 12 Jul 2007 20:22

All required files are present for Chain "2hufA"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2hufA"

Flow stage update by auto on 23 Feb 2007 17:33

Chain passed the SIFT criteria

Insertion by auto on 28 Sep 2006 15:51

Adding chain from chain pdb dir "/cath/data/current/chainpdb"