Flow stage update by auto on 10 Jan 2007 19:24
Final ChopClose added based on similarity with "1k4cC"
| Domain ID | CATH code | Image |
|---|---|---|
| 2hjfC00 | 1.10.287.70 |
>pdb|2hjfC SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT SFGLVTAALATWFVGREQERRGH
Final ChopClose added based on similarity with "1k4cC"
Final ChopClose added based on similarity with "1k4cC"
Putative ChopClose added based on similarity with "1k4cC"
No in_process hits for Chain "2hjfC" ready to be processed
NW result present for Chain "2hjfC"
All required files are present for Chain "2hjfC"
Beginning processing for Chain "2hjfC"
Chain passed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/current/chainpdb"