PDB Chain: 2hjfC

Molscript image for 2hjfC
2hjfC
PDB coordinates for chain 2hjfC

PDB 2hjf, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2hjfC00 1.10.287.70 Molscript image for 2hjfC00

Domain boundaries for PDB chain 2hjfC

Chain ATOM Sequence

>pdb|2hjfC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH    

Chain COMBS Sequence

>pdb|2hjfC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH    

Chain History Events (9)

Flow stage update by auto on 10 Jan 2007 19:24

Final ChopClose added based on similarity with "1k4cC"

Chain chopped by auto on 10 Jan 2007 19:24

Final ChopClose added based on similarity with "1k4cC"

Chain chopping chopclose by auto on 10 Jan 2007 19:24

Putative ChopClose added based on similarity with "1k4cC"

Flow stage update by auto on 10 Jan 2007 19:14

No in_process hits for Chain "2hjfC" ready to be processed

Flow stage update by auto on 10 Jan 2007 19:14

NW result present for Chain "2hjfC"

Flow stage update by auto on 10 Jan 2007 19:14

All required files are present for Chain "2hjfC"

Flow stage update by auto on 09 Jan 2007 19:14

Beginning processing for Chain "2hjfC"

Flow stage update by auto on 09 Jan 2007 17:00

Chain passed the SIFT criteria

Insertion by auto on 09 Jan 2007 17:00

Adding chain from chain pdb dir "/cath/data/current/chainpdb"