PDB Chain: 2hg5C

Molscript image for 2hg5C
2hg5C
PDB coordinates for chain 2hg5C

PDB 2hg5, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2hg5C00 1.10.287.70 Molscript image for 2hg5C00

Domain boundaries for PDB chain 2hg5C

Chain ATOM Sequence

>pdb|2hg5C
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY    

Chain COMBS Sequence

>pdb|2hg5C
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY    

Chain History Events (17)

Flow stage update by auto on 18 May 2010 00:29

Final ChopClose added based on similarity with "2h8pC"

Chain chopped by auto on 18 May 2010 00:29

Final ChopClose added based on similarity with "2h8pC"

Chain chopping chopclose by auto on 18 May 2010 00:29

Putative ChopClose added based on similarity with "2h8pC"

Flow stage update by auto on 17 May 2010 23:34

No in_process hits for Chain "2hg5C" ready to be processed

Update comment by auto on 17 May 2010 22:57

Chain "2hg5C" hits Chain "2hfeC" (100% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 17:52

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 18:03

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 13:32

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 10:26

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 17:47

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Update comment by auto on 12 Jul 2007 20:57

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:48

Chain "2hg5C" hits Chain "2h8pC" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2hg5C"

Flow stage update by auto on 12 Jul 2007 20:21

All required files are present for Chain "2hg5C"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2hg5C"

Flow stage update by auto on 23 Feb 2007 17:33

Chain passed the SIFT criteria

Insertion by auto on 14 Sep 2006 15:28

Adding chain from chain pdb dir "/cath/data/current/chainpdb"