PDB Chain: 2hg5A

Molscript image for 2hg5A
2hg5A
PDB coordinates for chain 2hg5A

PDB 2hg5, Chain A

CATH Domains (2)

Domain IDCATH codeImage
2hg5A01 2.60.40.10 Molscript image for 2hg5A01
2hg5A02 2.60.40.10 Molscript image for 2hg5A02

Domain boundaries for PDB chain 2hg5A

Chain ATOM Sequence

>pdb|2hg5A
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD    

Chain COMBS Sequence

>pdb|2hg5A
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD    

Chain History Events (108)

Flow stage update by auto on 26 Oct 2009 17:19

Final ChopClose added based on similarity with "1k4cA"

Chain chopped by auto on 26 Oct 2009 17:19

Final ChopClose added based on similarity with "1k4cA"

Chain chopping chopclose by auto on 26 Oct 2009 17:19

Putative ChopClose added based on similarity with "1k4cA"

Flow stage update by auto on 26 Oct 2009 17:17

No in_process hits for Chain "2hg5A" ready to be processed

Update comment by auto on 26 Oct 2009 17:15

Chain "2hg5A" hits Chain "2hfeA" (100% over 100%) which is currently in process

Update comment by auto on 26 Oct 2009 17:12

Chain "2hg5A" hits Chain "2hffH" (57.9908675799087% over 94.3965517241379%) which is currently in process

Update comment by auto on 26 Oct 2009 17:10

Chain "2hg5A" hits Chain "2hffB" (57.9908675799087% over 94.3965517241379%) which is currently in process

Update comment by auto on 26 Oct 2009 17:08

Chain "2hg5A" hits Chain "2hfgH" (57.5342465753425% over 94.3965517241379%) which is currently in process

Update comment by auto on 26 Oct 2009 17:05

Chain "2hg5A" hits Chain "2h9gB" (56.1643835616438% over 96.0526315789474%) which is currently in process

Update comment by auto on 26 Oct 2009 17:03

Chain "2hg5A" hits Chain "2h9gH" (56.1643835616438% over 96.0526315789474%) which is currently in process

Update comment by auto on 26 Oct 2009 17:00

Chain "2hg5A" hits Chain "2h8pA" (100% over 100%) which is currently in process

Update comment by auto on 26 Oct 2009 16:58

Chain "2hg5A" hits Chain "2h32H" (43.37899543379% over 98.2062780269058%) which is currently in process

Update comment by auto on 26 Oct 2009 16:55

Chain "2hg5A" hits Chain "2cmrH" (63.5944700460829% over 98.1735159817352%) which is currently in process

Update comment by auto on 26 Oct 2009 16:53

Chain "2hg5A" hits Chain "2gsiH" (76.2557077625571% over 98.1900452488688%) which is currently in process

Update comment by auto on 26 Oct 2009 16:50

Chain "2hg5A" hits Chain "2gsiF" (76.2557077625571% over 98.1900452488688%) which is currently in process

Update comment by auto on 26 Oct 2009 16:48

Chain "2hg5A" hits Chain "2gsiB" (76.2557077625571% over 98.1900452488688%) which is currently in process

Update comment by auto on 26 Oct 2009 16:45

Chain "2hg5A" hits Chain "2gsiD" (76.2557077625571% over 98.1900452488688%) which is currently in process

Update comment by auto on 26 Oct 2009 16:43

Chain "2hg5A" hits Chain "2gcyB" (55.5045871559633% over 99.0867579908676%) which is currently in process

Update comment by auto on 26 Oct 2009 16:41

Chain "2hg5A" hits Chain "2g75A" (65.296803652968% over 99.5433789954338%) which is currently in process

Update comment by auto on 26 Oct 2009 16:38

Chain "2hg5A" hits Chain "2g75C" (65.296803652968% over 99.5433789954338%) which is currently in process

Update comment by auto on 26 Oct 2009 16:36

Chain "2hg5A" hits Chain "2g60H" (80% over 98.1735159817352%) which is currently in process

Update comment by auto on 26 Oct 2009 16:33

Chain "2hg5A" hits Chain "2g2rB" (70.3196347031963% over 100%) which is currently in process

Update comment by auto on 26 Oct 2009 16:24

Chain "2hg5A" hits Chain "2g2rH" (70.3196347031963% over 100%) which is currently in process

Update comment by auto on 26 Oct 2009 16:15

Chain "2hg5A" hits Chain "2fx8I" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 16:13

Chain "2hg5A" hits Chain "2fx8H" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 16:10

Chain "2hg5A" hits Chain "2fx8J" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 16:08

Chain "2hg5A" hits Chain "2fx8K" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 16:05

Chain "2hg5A" hits Chain "2fx7H" (60.7305936073059% over 95.6140350877193%) which is currently in process

Update comment by auto on 26 Oct 2009 16:03

Chain "2hg5A" hits Chain "2fx9I" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 16:00

Chain "2hg5A" hits Chain "2fx9H" (60.7305936073059% over 95.5947136563877%) which is currently in process

Update comment by auto on 26 Oct 2009 15:57

Chain "2hg5A" hits Chain "2ddqH" (78.8732394366197% over 97.2602739726027%) which is currently in process

Update comment by auto on 26 Oct 2009 15:54

Chain "2hg5A" hits Chain "2dd8H" (65.296803652968% over 99.0950226244344%) which is currently in process

Update comment by auto on 26 Oct 2009 15:52

Chain "2hg5A" hits Chain "2fr4H" (83.5616438356164% over 95.2173913043478%) which is currently in process

Update comment by auto on 26 Oct 2009 15:49

Chain "2hg5A" hits Chain "2fr4B" (83.5616438356164% over 95.2173913043478%) which is currently in process

Update comment by auto on 26 Oct 2009 15:47

Chain "2hg5A" hits Chain "2fatH" (82.2429906542056% over 97.7168949771689%) which is currently in process

Update comment by auto on 26 Oct 2009 15:44

Chain "2hg5A" hits Chain "2bdnH" (75.1152073732719% over 99.0867579908676%) which is currently in process

Update comment by auto on 26 Oct 2009 15:42

Chain "2hg5A" hits Chain "2b2xI" (72.6027397260274% over 96.4601769911504%) which is currently in process

Update comment by auto on 26 Oct 2009 15:39

Chain "2hg5A" hits Chain "2b2xH" (72.6027397260274% over 96.4601769911504%) which is currently in process

Update comment by auto on 26 Oct 2009 15:36

Chain "2hg5A" hits Chain "2b1aH" (57.0776255707763% over 96.9026548672566%) which is currently in process

Update comment by auto on 26 Oct 2009 15:34

Chain "2hg5A" hits Chain "2b1hH" (57.0776255707763% over 96.9026548672566%) which is currently in process

Update comment by auto on 26 Oct 2009 15:28

Chain "2hg5A" hits Chain "1bbjB" (69.811320754717% over 96.3470319634703%) which is currently in process

Update comment by auto on 26 Oct 2009 15:21

Chain "2hg5A" hits Chain "3c09H" (68.0365296803653% over 98.2062780269058%) which is currently in process

Update comment by auto on 26 Oct 2009 15:17

Chain "2hg5A" hits Chain "3c09C" (68.0365296803653% over 98.2062780269058%) which is currently in process

Update comment by auto on 26 Oct 2009 15:15

Chain "2hg5A" hits Chain "3bkyH" (68.9497716894977% over 96.9026548672566%) which is currently in process

Update comment by auto on 26 Oct 2009 15:12

Chain "2hg5A" hits Chain "3b2uC" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 15:10

Chain "2hg5A" hits Chain "3b2uF" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 15:07

Chain "2hg5A" hits Chain "3b2uH" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 15:04

Chain "2hg5A" hits Chain "3b2uN" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 15:01

Chain "2hg5A" hits Chain "3b2uT" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 14:58

Chain "2hg5A" hits Chain "3b2uQ" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 14:55

Chain "2hg5A" hits Chain "3b2uJ" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 14:52

Chain "2hg5A" hits Chain "3b2uW" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 14:44

Chain "2hg5A" hits Chain "3b2vH" (55.2511415525114% over 97.7578475336323%) which is currently in process

Update comment by auto on 26 Oct 2009 14:28

Chain "2hg5A" hits Chain "2r69H" (77.5700934579439% over 97.7168949771689%) which is currently in process

Update comment by auto on 26 Oct 2009 14:18

Chain "2hg5A" hits Chain "2r4rH" (83.4101382488479% over 97.7168949771689%) which is currently in process

Update comment by auto on 26 Oct 2009 14:15

Chain "2hg5A" hits Chain "2r4sH" (83.4101382488479% over 97.7168949771689%) which is currently in process

Update comment by auto on 26 Oct 2009 14:11

Chain "2hg5A" hits Chain "2r29H" (77.3148148148148% over 98.6301369863014%) which is currently in process

Update comment by auto on 26 Oct 2009 14:08

Chain "2hg5A" hits Chain "2qscH" (55.7077625570776% over 97.2972972972973%) which is currently in process

Update comment by auto on 26 Oct 2009 13:59

Chain "2hg5A" hits Chain "2qqkH" (57.5342465753425% over 94.8051948051948%) which is currently in process

Update comment by auto on 26 Oct 2009 13:47

Chain "2hg5A" hits Chain "2qqlH" (57.5342465753425% over 94.8051948051948%) which is currently in process

Update comment by auto on 26 Oct 2009 13:29

Chain "2hg5A" hits Chain "2qqnH" (57.9908675799087% over 95.2173913043478%) which is currently in process

Update comment by auto on 26 Oct 2009 13:10

Chain "2hg5A" hits Chain "2b0sH" (57.0776255707763% over 96.9026548672566%) which is currently in process

Update comment by auto on 05 Dec 2008 20:10

Chain "2hg5A" hits Chain "2j88H" (58.6387434554974% over 86.3013698630137%) which is currently in process

Update comment by auto on 05 Dec 2008 19:09

Chain "2hg5A" hits Chain "2gkiA" (46.5753424657534% over 86.0557768924303%) which is currently in process

Update comment by auto on 05 Dec 2008 19:06

Chain "2hg5A" hits Chain "2gk0B" (63.013698630137% over 98.1900452488688%) which is currently in process

Update comment by auto on 05 Dec 2008 19:02

Chain "2hg5A" hits Chain "2gjzB" (63.013698630137% over 98.1900452488688%) which is currently in process

Update comment by auto on 05 Dec 2008 18:56

Chain "2hg5A" hits Chain "2gjzH" (63.013698630137% over 98.1900452488688%) which is currently in process

Update comment by auto on 05 Dec 2008 18:52

Chain "2hg5A" hits Chain "2gk0H" (63.013698630137% over 98.1900452488688%) which is currently in process

Update comment by auto on 05 Dec 2008 18:49

Chain "2hg5A" hits Chain "2g5bB" (69.4063926940639% over 97.7477477477478%) which is currently in process

Update comment by auto on 05 Dec 2008 18:46

Chain "2hg5A" hits Chain "2g5bF" (69.4063926940639% over 97.7477477477478%) which is currently in process

Update comment by auto on 05 Dec 2008 18:43

Chain "2hg5A" hits Chain "2g5bH" (69.4063926940639% over 97.7477477477478%) which is currently in process

Update comment by auto on 05 Dec 2008 18:40

Chain "2hg5A" hits Chain "2g5bD" (69.4063926940639% over 97.7477477477478%) which is currently in process

Update comment by auto on 05 Dec 2008 18:37

Chain "2hg5A" hits Chain "2fl5F" (53.4246575342466% over 98.6363636363636%) which is currently in process

Update comment by auto on 05 Dec 2008 18:33

Chain "2hg5A" hits Chain "2fl5H" (53.4246575342466% over 98.6363636363636%) which is currently in process

Update comment by auto on 05 Dec 2008 18:30

Chain "2hg5A" hits Chain "2fl5D" (53.4246575342466% over 98.6363636363636%) which is currently in process

Update comment by auto on 05 Dec 2008 18:26

Chain "2hg5A" hits Chain "2fl5B" (53.4246575342466% over 98.6363636363636%) which is currently in process

Update comment by auto on 05 Dec 2008 18:22

Chain "2hg5A" hits Chain "2arjB" (61.3953488372093% over 98.1735159817352%) which is currently in process

Update comment by auto on 05 Dec 2008 18:18

Chain "2hg5A" hits Chain "2arjH" (61.3953488372093% over 98.1735159817352%) which is currently in process

Update comment by auto on 05 Dec 2008 18:14

Chain "2hg5A" hits Chain "2aj3F" (54.337899543379% over 95.1754385964912%) which is currently in process

Update comment by auto on 05 Dec 2008 18:10

Chain "2hg5A" hits Chain "2aj3D" (54.337899543379% over 95.1754385964912%) which is currently in process

Update comment by auto on 05 Dec 2008 18:05

Chain "2hg5A" hits Chain "2aj3B" (54.337899543379% over 95.1754385964912%) which is currently in process

Update comment by auto on 05 Dec 2008 18:01

Chain "2hg5A" hits Chain "3bkmH" (59.8173515981735% over 96.4285714285714%) which is currently in process

Update comment by auto on 05 Dec 2008 17:57

Chain "2hg5A" hits Chain "3bkjH" (59.8173515981735% over 96.4285714285714%) which is currently in process

Update comment by auto on 05 Dec 2008 17:51

Chain "2hg5A" hits Chain "3baeH" (60.2739726027397% over 95.6140350877193%) which is currently in process

Update comment by auto on 05 Dec 2008 17:45

Chain "2hg5A" hits Chain "2r9hE" (69.8630136986301% over 98.6425339366516%) which is currently in process

Update comment by auto on 05 Dec 2008 17:32

Chain "2hg5A" hits Chain "2r9hC" (69.8630136986301% over 98.6425339366516%) which is currently in process

Update comment by auto on 05 Dec 2008 17:12

Chain "2hg5A" hits Chain "2dtgA" (68.4931506849315% over 99.0909090909091%) which is currently in process

Update comment by auto on 05 Dec 2008 17:03

Chain "2hg5A" hits Chain "2dtgC" (86.046511627907% over 97.7168949771689%) which is currently in process

Update comment by auto on 23 Jul 2008 17:52

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 03 Sep 2007 18:03

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 03 Sep 2007 13:32

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 11 Aug 2007 10:26

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 10 Aug 2007 17:47

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 15 Jul 2007 10:04

Chain "2hg5A" hits Chain "2aepH" (57.2192513368984% over 84.4748858447489%) which is currently in process

Update comment by auto on 15 Jul 2007 06:07

Chain "2hg5A" hits Chain "2a6kH" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 15 Jul 2007 02:09

Chain "2hg5A" hits Chain "2a6kB" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 14 Jul 2007 22:05

Chain "2hg5A" hits Chain "2a6dH" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 14 Jul 2007 20:05

Chain "2hg5A" hits Chain "2a6dB" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 14 Jul 2007 16:08

Chain "2hg5A" hits Chain "2a6jH" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 14 Jul 2007 10:07

Chain "2hg5A" hits Chain "2a6jB" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 14 Jul 2007 04:05

Chain "2hg5A" hits Chain "2a6iB" (84.0182648401827% over 98.6486486486486%) which is currently in process

Update comment by auto on 12 Jul 2007 20:57

Chain "2hg5A" hits Chain "1zeaH" (72.2222222222222% over 98.6301369863014%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:48

Chain "2hg5A" hits Chain "1zeaH" (72.2222222222222% over 98.6301369863014%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2hg5A"

Flow stage update by auto on 12 Jul 2007 20:21

All required files are present for Chain "2hg5A"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2hg5A"

Flow stage update by auto on 23 Feb 2007 17:33

Chain passed the SIFT criteria

Insertion by auto on 14 Sep 2006 15:28

Adding chain from chain pdb dir "/cath/data/current/chainpdb"