PDB Chain: 2h8pC

Molscript image for 2h8pC
2h8pC
PDB coordinates for chain 2h8pC

PDB 2h8p, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2h8pC00 1.10.287.70 Molscript image for 2h8pC00

Domain boundaries for PDB chain 2h8pC

Chain ATOM Sequence

>pdb|2h8pC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY    

Chain COMBS Sequence

>pdb|2h8pC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWACETATTVGY    

Chain History Events (41)

Flow stage update by cuff on 17 May 2010 15:25

nice chopping

Chain chopped by cuff on 17 May 2010 15:25

nice chopping

Chain chopping manual by tronnberg on 09 Aug 2007 16:21

WCD

Domchop review by tronnberg on 09 Aug 2007 16:21

WCD

Flow stage update by tronnberg on 09 Aug 2007 16:21

WCD

Domchop allotment by tronnberg on 09 Aug 2007 16:21

User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.

Flow stage update by tronnberg on 09 Aug 2007 16:21

User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.

Flow stage update by auto on 06 Aug 2007 08:25

Retrieved HMM(SAM) results for job ID SID7062889960089070 and inserted them into the database.

Chain chopping hmm by auto on 06 Aug 2007 08:25

Chain HMM chopping

Update comment by auto on 06 Aug 2007 01:34

HMM(SAM) job SID7062889960089070 is not yet finished.

Flow stage update by auto on 06 Aug 2007 00:05

The entry "2h8pC" has been submitted to the HMM (SAM) webservice.

Hmm submit by auto on 06 Aug 2007 00:05

The entry "2h8pC" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Aug 2007 23:03

Retrieved "2h8pC" CATHEDRAL results for job ID SID1925273512846256 and inserted them into the database.

Chain chopping cathedral by auto on 05 Aug 2007 23:03

Chain "2h8pC" CATHEDRAL chopping from job SID1925273512846256

Update comment by auto on 05 Aug 2007 17:25

"2h8pC" CATHEDRAL job SID1925273512846256 is not yet finished.

Cathedral submit by auto on 05 Aug 2007 15:32

The entry "2h8pC" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Aug 2007 15:32

The entry "2h8pC" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Aug 2007 11:16

ScanList with 9616 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2h8pC.scanlist" for "2h8pC"

Update comment by auto on 05 Aug 2007 06:43

Waiting for 2895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 02:38

Waiting for 2937 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:23

Waiting for 2979 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 18:30

Waiting for 3049 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 14:31

Waiting for 3117 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 10:32

Waiting for 3173 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:27

Waiting for 3227 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 02:35

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:28

Waiting for 3261 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:17

Waiting for 3262 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:12

Waiting for 3306 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 03 Aug 2007 14:42

Added putative Choppings from the DBS that ran () for Chain "2h8pC"

Flow stage update by auto on 03 Aug 2007 14:19

Number of chains in ballcock flow stages is 775 which is less than the max allowed of 800

Update comment by auto on 28 Jul 2007 22:17

Number of chains in ballcock flow stages is 800 which hits the the max allowed of 800

Update comment by auto on 13 Jul 2007 16:21

Number of chains in ballcock flow stages is 400 which hits the the max allowed of 400

Flow stage update by auto on 13 Jul 2007 08:18

ChopClose result is not good enough for automatic chopping

Chain chopping chopclose by auto on 13 Jul 2007 08:18

Putative ChopClose added based on similarity with "1s5lz"

Flow stage update by auto on 12 Jul 2007 20:47

No in_process hits for Chain "2h8pC" ready to be processed

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2h8pC"

Flow stage update by auto on 12 Jul 2007 20:20

All required files are present for Chain "2h8pC"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2h8pC"

Flow stage update by auto on 23 Feb 2007 17:33

Chain passed the SIFT criteria

Insertion by auto on 14 Sep 2006 15:28

Adding chain from chain pdb dir "/cath/data/current/chainpdb"