PDB Chain: 2h8pB

Molscript image for 2h8pB
2h8pB
PDB coordinates for chain 2h8pB

PDB 2h8p, Chain B

CATH Domains (2)

Domain IDCATH codeImage
2h8pB01 2.60.40.10 Molscript image for 2h8pB01
2h8pB02 2.60.40.10 Molscript image for 2h8pB02

Domain boundaries for PDB chain 2h8pB

Chain ATOM Sequence

>pdb|2h8pB
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN    

Chain COMBS Sequence

>pdb|2h8pB
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN    

Chain History Events (101)

Flow stage update by auto on 05 Dec 2008 21:58

Final ChopClose added based on similarity with "1k4cB"

Chain chopped by auto on 05 Dec 2008 21:58

Final ChopClose added based on similarity with "1k4cB"

Chain chopping chopclose by auto on 05 Dec 2008 21:58

Putative ChopClose added based on similarity with "1k4cB"

Flow stage update by auto on 05 Dec 2008 21:55

No in_process hits for Chain "2h8pB" ready to be processed

Update comment by auto on 05 Dec 2008 21:52

Chain "2h8pB" hits Chain "2dqtL" (78.3018867924528% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 21:50

Chain "2h8pB" hits Chain "2dquL" (78.3018867924528% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 21:47

Chain "2h8pB" hits Chain "2h2pD" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 21:45

Chain "2h8pB" hits Chain "2h2sF" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 21:42

Chain "2h8pB" hits Chain "2h2sD" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 21:40

Chain "2h8pB" hits Chain "2h2pF" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 21:37

Chain "2h8pB" hits Chain "2cmrL" (59.6153846153846% over 98.1132075471698%) which is currently in process

Update comment by auto on 05 Dec 2008 21:34

Chain "2h8pB" hits Chain "2gsiE" (77.3584905660377% over 98.1395348837209%) which is currently in process

Update comment by auto on 05 Dec 2008 21:31

Chain "2h8pB" hits Chain "2gsiG" (77.3584905660377% over 98.1395348837209%) which is currently in process

Update comment by auto on 05 Dec 2008 21:29

Chain "2h8pB" hits Chain "2gsiA" (77.3584905660377% over 98.1395348837209%) which is currently in process

Update comment by auto on 05 Dec 2008 21:26

Chain "2h8pB" hits Chain "2gsiC" (77.3584905660377% over 98.1395348837209%) which is currently in process

Update comment by auto on 05 Dec 2008 21:24

Chain "2h8pB" hits Chain "2gk0L" (78.7735849056604% over 97.6958525345622%) which is currently in process

Update comment by auto on 05 Dec 2008 21:20

Chain "2h8pB" hits Chain "2gk0A" (78.7735849056604% over 97.6958525345622%) which is currently in process

Update comment by auto on 05 Dec 2008 21:17

Chain "2h8pB" hits Chain "2gjzL" (78.7735849056604% over 97.6958525345622%) which is currently in process

Update comment by auto on 05 Dec 2008 21:14

Chain "2h8pB" hits Chain "2gjzA" (78.7735849056604% over 97.6958525345622%) which is currently in process

Update comment by auto on 05 Dec 2008 21:11

Chain "2h8pB" hits Chain "2gcyA" (63.6792452830189% over 98.1481481481482%) which is currently in process

Update comment by auto on 05 Dec 2008 21:09

Chain "2h8pB" hits Chain "2g75B" (37.7358490566038% over 98.5915492957746%) which is currently in process

Update comment by auto on 05 Dec 2008 21:06

Chain "2h8pB" hits Chain "2g75D" (37.7358490566038% over 98.5915492957746%) which is currently in process

Update comment by auto on 05 Dec 2008 21:04

Chain "2h8pB" hits Chain "2g60L" (77.8301886792453% over 97.6851851851852%) which is currently in process

Update comment by auto on 05 Dec 2008 21:01

Chain "2h8pB" hits Chain "2g5bE" (78.7735849056604% over 97.2350230414746%) which is currently in process

Update comment by auto on 05 Dec 2008 20:58

Chain "2h8pB" hits Chain "2g5bA" (78.7735849056604% over 97.2350230414746%) which is currently in process

Update comment by auto on 05 Dec 2008 20:56

Chain "2h8pB" hits Chain "2g5bC" (78.7735849056604% over 97.2350230414746%) which is currently in process

Update comment by auto on 05 Dec 2008 20:53

Chain "2h8pB" hits Chain "2g5bG" (78.7735849056604% over 97.2350230414746%) which is currently in process

Update comment by auto on 05 Dec 2008 20:50

Chain "2h8pB" hits Chain "2g2rA" (76.8867924528302% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 20:48

Chain "2h8pB" hits Chain "2g2rL" (76.8867924528302% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 20:45

Chain "2h8pB" hits Chain "2fx8L" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:43

Chain "2h8pB" hits Chain "2fx7L" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:40

Chain "2h8pB" hits Chain "2fx8O" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:38

Chain "2h8pB" hits Chain "2fx8N" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:35

Chain "2h8pB" hits Chain "2fx9M" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:32

Chain "2h8pB" hits Chain "2fx8M" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:30

Chain "2h8pB" hits Chain "2fx9L" (60.377358490566% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:27

Chain "2h8pB" hits Chain "2ddqL" (78.7735849056604% over 97.2477064220184%) which is currently in process

Update comment by auto on 05 Dec 2008 20:24

Chain "2h8pB" hits Chain "2dd8L" (37.7358490566038% over 98.5915492957746%) which is currently in process

Update comment by auto on 05 Dec 2008 20:18

Chain "2h8pB" hits Chain "2fr4L" (76.8867924528302% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:15

Chain "2h8pB" hits Chain "2fr4A" (76.8867924528302% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 20:12

Chain "2h8pB" hits Chain "2fatL" (78.3018867924528% over 99.0566037735849%) which is currently in process

Update comment by auto on 05 Dec 2008 20:10

Chain "2h8pB" hits Chain "2bdnL" (77.8301886792453% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 19:52

Chain "2h8pB" hits Chain "2b2xM" (77.3584905660377% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:49

Chain "2h8pB" hits Chain "2b2xL" (77.3584905660377% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:47

Chain "2h8pB" hits Chain "2b1aL" (37.2641509433962% over 96.7441860465116%) which is currently in process

Update comment by auto on 05 Dec 2008 19:44

Chain "2h8pB" hits Chain "2b1hL" (37.2641509433962% over 96.7441860465116%) which is currently in process

Update comment by auto on 05 Dec 2008 19:41

Chain "2h8pB" hits Chain "2b0sL" (37.2641509433962% over 96.7441860465116%) which is currently in process

Update comment by auto on 05 Dec 2008 19:38

Chain "2h8pB" hits Chain "2arjA" (70.6161137440758% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 19:36

Chain "2h8pB" hits Chain "2arjL" (70.6161137440758% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 19:32

Chain "2h8pB" hits Chain "2aj3C" (57.5471698113208% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:29

Chain "2h8pB" hits Chain "2aj3A" (57.5471698113208% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:27

Chain "2h8pB" hits Chain "2aj3E" (57.5471698113208% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:23

Chain "2h8pB" hits Chain "2agjL" (60.8490566037736% over 98.6046511627907%) which is currently in process

Update comment by auto on 05 Dec 2008 19:19

Chain "2h8pB" hits Chain "1bbjA" (60.1895734597156% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 19:15

Chain "2h8pB" hits Chain "3c09L" (58.9622641509434% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 19:12

Chain "2h8pB" hits Chain "3c09B" (58.9622641509434% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 19:09

Chain "2h8pB" hits Chain "3bkmL" (79.2452830188679% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 19:06

Chain "2h8pB" hits Chain "3bkyL" (58.9622641509434% over 99.0610328638498%) which is currently in process

Update comment by auto on 05 Dec 2008 19:02

Chain "2h8pB" hits Chain "3bkjL" (79.2452830188679% over 96.8036529680365%) which is currently in process

Update comment by auto on 05 Dec 2008 18:56

Chain "2h8pB" hits Chain "3baeL" (79.2452830188679% over 97.2477064220184%) which is currently in process

Update comment by auto on 05 Dec 2008 18:52

Chain "2h8pB" hits Chain "3b2uK" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:49

Chain "2h8pB" hits Chain "3b2uD" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:46

Chain "2h8pB" hits Chain "3b2uR" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:43

Chain "2h8pB" hits Chain "3b2vL" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:40

Chain "2h8pB" hits Chain "3b2uU" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:37

Chain "2h8pB" hits Chain "3b2uO" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:33

Chain "2h8pB" hits Chain "3b2uX" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:30

Chain "2h8pB" hits Chain "3b2uG" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:26

Chain "2h8pB" hits Chain "3b2uL" (61.3207547169811% over 99.5305164319249%) which is currently in process

Update comment by auto on 05 Dec 2008 18:22

Chain "2h8pB" hits Chain "2r9hD" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 18:18

Chain "2h8pB" hits Chain "2r9hF" (78.1990521327014% over 99.5283018867924%) which is currently in process

Update comment by auto on 05 Dec 2008 18:14

Chain "2h8pB" hits Chain "2r69L" (79.2452830188679% over 97.6415094339623%) which is currently in process

Update comment by auto on 05 Dec 2008 18:10

Chain "2h8pB" hits Chain "2r4sL" (74.5283018867924% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 18:05

Chain "2h8pB" hits Chain "2r4rL" (74.5283018867924% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 18:01

Chain "2h8pB" hits Chain "2r29L" (81.6037735849057% over 97.6958525345622%) which is currently in process

Update comment by auto on 05 Dec 2008 17:57

Chain "2h8pB" hits Chain "2qscL" (55.6603773584906% over 98.6046511627907%) which is currently in process

Update comment by auto on 05 Dec 2008 17:51

Chain "2h8pB" hits Chain "2qqlL" (59.9056603773585% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 17:45

Chain "2h8pB" hits Chain "2qqnL" (59.9056603773585% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 17:32

Chain "2h8pB" hits Chain "2qqkL" (59.9056603773585% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 17:12

Chain "2h8pB" hits Chain "2dtgD" (76.8867924528302% over 99.0654205607477%) which is currently in process

Update comment by auto on 05 Dec 2008 17:03

Chain "2h8pB" hits Chain "2dtgB" (79.2452830188679% over 96.3470319634703%) which is currently in process

Update comment by auto on 23 Jul 2008 17:51

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 03 Sep 2007 18:02

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 03 Sep 2007 13:32

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 11 Aug 2007 10:26

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 10 Aug 2007 17:47

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 15 Jul 2007 10:04

Chain "2h8pB" hits Chain "2aepL" (75.4385964912281% over 80.6603773584906%) which is currently in process

Update comment by auto on 15 Jul 2007 06:07

Chain "2h8pB" hits Chain "2a6kA" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 15 Jul 2007 02:09

Chain "2h8pB" hits Chain "2a6kL" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 14 Jul 2007 22:05

Chain "2h8pB" hits Chain "2a6iA" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 14 Jul 2007 20:05

Chain "2h8pB" hits Chain "2a6dL" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 14 Jul 2007 16:07

Chain "2h8pB" hits Chain "2a6jL" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 14 Jul 2007 10:07

Chain "2h8pB" hits Chain "2a6jA" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 14 Jul 2007 04:05

Chain "2h8pB" hits Chain "2a6dA" (79.7169811320755% over 99.0654205607477%) which is currently in process

Update comment by auto on 12 Jul 2007 20:57

Chain "2h8pB" hits Chain "1zeaL" (79.2452830188679% over 97.6851851851852%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:47

Chain "2h8pB" hits Chain "1zeaL" (79.2452830188679% over 97.6851851851852%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2h8pB"

Flow stage update by auto on 12 Jul 2007 20:20

All required files are present for Chain "2h8pB"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2h8pB"

Flow stage update by auto on 23 Feb 2007 17:33

Chain passed the SIFT criteria

Insertion by auto on 14 Sep 2006 15:28

Adding chain from chain pdb dir "/cath/data/current/chainpdb"