Flow stage update by cuff on 20 Aug 2007 10:54
nice chopping
PDB Chain: 2gviA
2gviA
PDB 2gvi, Chain A
CATH Domains (3)
| Domain ID | CATH code | Image |
|---|---|---|
| 2gviA01 | 1.10.3320.10 | |
| 2gviA02 | 3.30.1330.20 | |
| 2gviA03 | 3.30.60.20 |
Chain ATOM Sequence
>pdb|2gviA EKLNFGIPEWAFEFHGHKCPYPGYRAGSYALKIAGLEKEKDHRTYLLSESPEDNGCFNDGAQAATGCTYGKGLFSLLGYG KLALILYRPGRKAIRVHVRNSFDELSTRASDFFRYRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVK KNGAKVRCDVCGEYTYEADAKLLNGKPVCKPDYYG
Chain History Events (47)
Chain chopped by cuff on 20 Aug 2007 10:54
nice chopping
Chain chopping manual by tronnberg on 20 Aug 2007 09:17
Three domains (?)
Domchop review by tronnberg on 20 Aug 2007 09:17
Three domains (?)
Flow stage update by tronnberg on 20 Aug 2007 09:17
Three domains (?)
Domchop return by cuff on 18 Aug 2007 13:15
you could almost see this as three domains. what do you think?
Flow stage update by cuff on 18 Aug 2007 13:15
you could almost see this as three domains. what do you think?
Domchop review by tronnberg on 05 Jul 2007 11:10
Two domians
Flow stage update by tronnberg on 05 Jul 2007 11:10
Two domians
Chain chopping manual by tronnberg on 05 Jul 2007 11:10
Two domians
Domchop allotment by tronnberg on 05 Jul 2007 11:05
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 05 Jul 2007 11:05
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by lewis on 04 Jul 2007 15:05
The HMM(SAM) scan for 2gviA returned no results and this doesn't appear to be an error so I am shifting 2gviA on to DOMCHOP_READY
Update comment by auto on 04 Jul 2007 14:50
HMM(SAM) job SID8623051777605152 for entry "2gviA" returned no results. In an ideal world, all HMM(SAM) scans would return results. This isn't an ideal world and we're all going to have to deal with that. You need to decide why this HMM(SAM) scan has returned no results. Is it because there are no good HMM hits or is it because something has gone wrong? SG structures are more likely to have no decent HMM(SAM) hits than normal structures.
If something has gone wrong, please track down the problem and fix it.
If you are happy that there is no problem, then you may wish to run a command like the following one:
/usr/local/svn/source/update/v3.1.1/utilities/UpdateFlowStage.pl -d cathdb_current -h fletcher -u
Update comment by auto on 04 Jul 2007 03:01
HMM(SAM) job SID8623051777605152 is not yet finished.
Hmm submit by auto on 04 Jul 2007 02:43
The entry "2gviA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Jul 2007 02:43
The entry "2gviA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Jul 2007 02:20
Retrieved "2gviA" CATHEDRAL results for job ID SID1306305030800400 and inserted them into the database.
Chain chopping cathedral by auto on 04 Jul 2007 02:20
Chain "2gviA" CATHEDRAL chopping from job SID1306305030800400
Update comment by auto on 03 Jul 2007 10:47
"2gviA" CATHEDRAL job SID1306305030800400 is not yet finished.
Flow stage update by auto on 03 Jul 2007 10:33
The entry "2gviA" has been submitted to the CATHEDRAL webservice.
Cathedral submit by auto on 03 Jul 2007 10:33
The entry "2gviA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Jul 2007 10:13
ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2gviA.scanlist" for "2gviA"
Update comment by auto on 03 Jul 2007 06:02
Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.
Update comment by auto on 03 Jul 2007 02:05
Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.
Update comment by auto on 02 Jul 2007 22:01
Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jun 2007 10:00
Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jun 2007 06:02
Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Update comment by auto on 30 Jun 2007 02:02
Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jun 2007 22:00
Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jun 2007 18:05
Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Update comment by auto on 29 Jun 2007 14:04
Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.
Chain chopping detective by auto on 29 Jun 2007 14:02
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping puu by auto on 29 Jun 2007 14:02
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 29 Jun 2007 14:02
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_PUU) for Chain "2gviA"
Flow stage update by auto on 29 Jun 2007 14:00
Number of chains in ballcock flow stages is 190 which is less than the max allowed of 200
Update comment by auto on 23 May 2007 16:15
Number of chains in ballcock flow stages is 200 which hits the the max allowed of 200
Update comment by auto on 27 Apr 2007 18:04
Number of chains in ballcock flow stages is 200 which hits the the max allowed of 200
Update comment by auto on 30 Mar 2007 21:16
Number of chains in ballcock flow stages is 50 which hits the the max allowed of 50
Flow stage update by auto on 30 Mar 2007 20:24
No ChopClose result provided for Chain "2gviA"
Flow stage update by auto on 30 Mar 2007 18:03
No in_process hits for Chain "2gviA" ready to be processed
Flow stage update by auto on 30 Mar 2007 18:00
NW result present for Chain "2gviA"
Flow stage update by auto on 30 Mar 2007 17:58
All required files are present for Chain "2gviA"
Flow stage update by auto on 30 Mar 2007 17:55
Beginning processing for Chain "2gviA"
Flow stage update by auto on 23 Feb 2007 17:33
Chain passed the SIFT criteria
Flow stage update by auto on 14 Jul 2006 16:00
Chain passed the SIFT criteria
Insertion by auto on 14 Jul 2006 15:58
Adding chain from chain pdb dir "/cath/data/current/chainpdb"
