Flow stage update by auto on 14 Jul 2007 10:40
Final ChopClose added based on similarity with "1k4cC"
| Domain ID | CATH code | Image |
|---|---|---|
| 2dwdC00 | 1.10.287.70 |
>pdb|2dwdC SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT SFGLVTAALATWFVGREQERRGH
Final ChopClose added based on similarity with "1k4cC"
Final ChopClose added based on similarity with "1k4cC"
Putative ChopClose added based on similarity with "1k4cC"
No in_process hits for Chain "2dwdC" ready to be processed
Chain "2dwdC" hits Chain "2hvjC" (100% over 100%) which is currently in process
Chain "2dwdC" hits Chain "2hvkC" (100% over 100%) which is currently in process
Chain "2dwdC" hits Chain "2hvkC" (100% over 100%) which is currently in process
NW result present for Chain "2dwdC"
All required files are present for Chain "2dwdC"
Beginning processing for Chain "2dwdC"
Chain passed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/current/chainpdb"