PDB Chain: 2dwdC

Molscript image for 2dwdC
2dwdC
PDB coordinates for chain 2dwdC

PDB 2dwd, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2dwdC00 1.10.287.70 Molscript image for 2dwdC00

[top]
Domain boundaries for PDB chain 2dwdC

Chopping figure for chain 2dwdC
Domain IDStart ResStop Res NameLength
2dwdC00 22 124 103

[top]
Chain ATOM Sequence 

>pdb|2dwdC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2dwdC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain History Events (12)

Flow stage update by auto on 14 Jul 2007 10:40

Final ChopClose added based on similarity with "1k4cC"

Chain chopped by auto on 14 Jul 2007 10:40

Final ChopClose added based on similarity with "1k4cC"

Chain chopping chopclose by auto on 14 Jul 2007 10:40

Putative ChopClose added based on similarity with "1k4cC"

Flow stage update by auto on 14 Jul 2007 10:08

No in_process hits for Chain "2dwdC" ready to be processed

Update comment by auto on 14 Jul 2007 04:06

Chain "2dwdC" hits Chain "2hvjC" (100% over 100%) which is currently in process

Update comment by auto on 12 Jul 2007 20:57

Chain "2dwdC" hits Chain "2hvkC" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:48

Chain "2dwdC" hits Chain "2hvkC" (100% over 100%) which is currently in process

Flow stage update by auto on 12 Jul 2007 20:36

NW result present for Chain "2dwdC"

Flow stage update by auto on 12 Jul 2007 20:23

All required files are present for Chain "2dwdC"

Flow stage update by auto on 12 Jul 2007 20:03

Beginning processing for Chain "2dwdC"

Flow stage update by auto on 23 Feb 2007 17:32

Chain passed the SIFT criteria

Insertion by auto on 23 Feb 2007 17:22

Adding chain from chain pdb dir "/cath/data/current/chainpdb"