PDB Chain: 2c4jA

Molscript image for 2c4jA
2c4jA
PDB coordinates for chain 2c4jA

PDB 2c4j, Chain A

CATH Domains (2)

Domain IDCATH codeImage
2c4jA01 3.40.30.10 Molscript image for 2c4jA01
2c4jA02 1.20.1050.10 Molscript image for 2c4jA02

[top]
Domain boundaries for PDB chain 2c4jA

Chopping figure for chain 2c4jA
Domain IDStart ResStop Res NameLength
2c4jA01 2 86 85
2c4jA01 192 218 27
2c4jA02 87 191 105

[top]
Chain ATOM Sequence 

>pdb|2c4jA
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIA
RKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAY
DVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2c4jA
MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYI
ARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIA
YDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
BLAST against CATH

[top]
Chain History Events (11)

Property update by auto on 01 Nov 2009 18:37

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.87984496124031" to "0.880110497237569"]

Property update by auto on 08 Nov 2007 02:01

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.880110497237569" to "0.87984496124031"]

Property update by auto on 14 Jul 2006 15:40

Updated the chain's properties [modified "combs_md5_code" from "611f4ab43a1be9919f7fe5fa177dfe26" to "48655507cfbd51689e6c7530b68f105d"] [modified "seqres_md5_code" from "611f4ab43a1be9919f7fe5fa177dfe26" to "48655507cfbd51689e6c7530b68f105d"]

Flow stage update by auto on 10 Mar 2006 20:13

Final ChopClose added based on similarity with "2c4jC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.06, SI: 100, SO: 100]

Chain chopped by auto on 10 Mar 2006 20:13

Final ChopClose added based on similarity with "2c4jC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.06, SI: 100, SO: 100]

Chain chopping chopclose by auto on 10 Mar 2006 20:13

Putative ChopClose added based on similarity with "2c4jC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.06, SI: 100, SO: 100]

Flow stage update by auto on 08 Mar 2006 14:28

NW result present for Chain "2c4jA"

Flow stage update by auto on 08 Mar 2006 14:26

All required files are present for Chain "2c4jA"

Flow stage update by auto on 08 Mar 2006 14:14

Beginning processing for Chain "2c4jA"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:17

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"