PDB Chain: 2atkC

Molscript image for 2atkC
2atkC
PDB coordinates for chain 2atkC

PDB 2atk, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2atkC00 1.10.287.70 Molscript image for 2atkC00

[top]
Domain boundaries for PDB chain 2atkC

Chopping figure for chain 2atkC
Domain IDStart ResStop Res NameLength
2atkC00 22 124 103

[top]
Chain ATOM Sequence 

>pdb|2atkC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2atkC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVATATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH
BLAST against CATH

[top]
Chain History Events (9)

Property update by auto on 14 Jul 2006 15:35

Updated the chain's properties [modified "seqres_md5_code" from "846dfd283a17235979142ed72bf519a3" to "8b8141fb391fae2ba4517b1e01805d72"]

Flow stage update by auto on 17 Mar 2006 19:23

Final ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.88, SI: 99.0291262135922, SO: 100]

Chain chopped by auto on 17 Mar 2006 19:23

Final ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.88, SI: 99.0291262135922, SO: 100]

Chain chopping chopclose by auto on 17 Mar 2006 19:23

Putative ChopClose added based on similarity with "1k4cC" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.88, SI: 99.0291262135922, SO: 100]

Flow stage update by auto on 17 Mar 2006 18:26

NW result present for Chain "2atkC"

Flow stage update by auto on 17 Mar 2006 18:26

All required files are present for Chain "2atkC"

Flow stage update by auto on 17 Mar 2006 18:26

Beginning processing for Chain "2atkC"

Flow stage update by auto on 15 Mar 2006 17:56

Chain passed the SIFT criteria

Insertion by auto on 15 Mar 2006 17:54

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"