Flow stage update by auto on 17 Mar 2006 19:23
Final ChopClose added based on similarity with "1k4cB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.76, SI: 100, SO: 100]
| Domain ID | CATH code | Image |
|---|---|---|
| 2atkB01 | 2.60.40.10 | |
| 2atkB02 | 2.60.40.10 |
>pdb|2atkB DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES EDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Final ChopClose added based on similarity with "1k4cB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.76, SI: 100, SO: 100]
Final ChopClose added based on similarity with "1k4cB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.76, SI: 100, SO: 100]
Putative ChopClose added based on similarity with "1k4cB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.76, SI: 100, SO: 100]
NW result present for Chain "2atkB"
All required files are present for Chain "2atkB"
Beginning processing for Chain "2atkB"
Chain passed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"