PDB Chain: 2atkA

Molscript image for 2atkA
2atkA
PDB coordinates for chain 2atkA

PDB 2atk, Chain A

CATH Domains (2)

Domain IDCATH codeImage
2atkA01 2.60.40.10 Molscript image for 2atkA01
2atkA02 2.60.40.10 Molscript image for 2atkA02

Domain boundaries for PDB chain 2atkA

Chain ATOM Sequence

>pdb|2atkA
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD    

Chain COMBS Sequence

>pdb|2atkA
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAF
MQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD    

Chain History Events (8)

Flow stage update by auto on 17 Mar 2006 19:23

Final ChopClose added based on similarity with "1k4cA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.03, SI: 100, SO: 100]

Chain chopped by auto on 17 Mar 2006 19:23

Final ChopClose added based on similarity with "1k4cA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.03, SI: 100, SO: 100]

Chain chopping chopclose by auto on 17 Mar 2006 19:23

Putative ChopClose added based on similarity with "1k4cA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 96.03, SI: 100, SO: 100]

Flow stage update by auto on 17 Mar 2006 18:26

NW result present for Chain "2atkA"

Flow stage update by auto on 17 Mar 2006 18:26

All required files are present for Chain "2atkA"

Flow stage update by auto on 17 Mar 2006 18:26

Beginning processing for Chain "2atkA"

Flow stage update by auto on 15 Mar 2006 17:56

Chain passed the SIFT criteria

Insertion by auto on 15 Mar 2006 17:54

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"