PDB Chain: 2a9hC

Molscript image for 2a9hC
2a9hC
PDB coordinates for chain 2a9hC

PDB 2a9h, Chain C

CATH Domains (1)

Domain IDCATH codeImage
2a9hC00 1.10.287.70 Molscript image for 2a9hC00

[top]
Domain boundaries for PDB chain 2a9hC

Chopping figure for chain 2a9hC
Domain IDStart ResStop Res NameLength
2a9hC00 23 119 97

[top]
Chain ATOM Sequence 

>pdb|2a9hC
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
YGLVFAAVATWFVGREQ
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2a9hC
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
YGLVFAAVATWFVGREQERRGHFVRHSEKA
BLAST against CATH

[top]
Chain History Events (9)

Property update by auto on 14 Jul 2006 15:34

Updated the chain's properties [modified "combs_md5_code" from "52a20a87b27e45547eeb049604683e94" to "43ab4496241bf92d63c637b08b06c8f9"] [modified "seqres_md5_code" from "52a20a87b27e45547eeb049604683e94" to "9e85bf7e51241d6ae6e0ccb178f1d8de"]

Flow stage update by auto on 15 Mar 2006 02:02

Final ChopClose added based on similarity with "2a9hA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.13, SI: 100, SO: 100]

Chain chopped by auto on 15 Mar 2006 02:02

Final ChopClose added based on similarity with "2a9hA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.13, SI: 100, SO: 100]

Chain chopping chopclose by auto on 15 Mar 2006 02:01

Putative ChopClose added based on similarity with "2a9hA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.13, SI: 100, SO: 100]

Flow stage update by auto on 15 Mar 2006 01:01

NW result present for Chain "2a9hC"

Flow stage update by auto on 08 Mar 2006 14:25

All required files are present for Chain "2a9hC"

Flow stage update by auto on 08 Mar 2006 14:14

Beginning processing for Chain "2a9hC"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:13

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"