PDB Chain: 2a9hA

Molscript image for 2a9hA
2a9hA
PDB coordinates for chain 2a9hA

PDB 2a9h, Chain A

CATH Domains (1)

Domain IDCATH codeImage
2a9hA00 1.10.287.70 Molscript image for 2a9hA00

[top]
Domain boundaries for PDB chain 2a9hA

Chopping figure for chain 2a9hA
Domain IDStart ResStop Res NameLength
2a9hA00 23 119 97

[top]
Chain ATOM Sequence 

>pdb|2a9hA
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
YGLVFAAVATWFVGREQ
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2a9hA
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
YGLVFAAVATWFVGREQERRGHFVRHSEKA
BLAST against CATH

[top]
Chain History Events (9)

Property update by auto on 14 Jul 2006 15:34

Updated the chain's properties [modified "combs_md5_code" from "52a20a87b27e45547eeb049604683e94" to "43ab4496241bf92d63c637b08b06c8f9"] [modified "seqres_md5_code" from "52a20a87b27e45547eeb049604683e94" to "9e85bf7e51241d6ae6e0ccb178f1d8de"]

Flow stage update by auto on 15 Mar 2006 02:01

Final ChopClose added based on similarity with "1j95A" [LEE: 1, LME: 0, MR: 2, LG: 2, SS: 91.16, SI: 94.1176470588235, SO: 92.7272727272727]

Chain chopped by auto on 15 Mar 2006 02:01

Final ChopClose added based on similarity with "1j95A" [LEE: 1, LME: 0, MR: 2, LG: 2, SS: 91.16, SI: 94.1176470588235, SO: 92.7272727272727]

Chain chopping chopclose by auto on 15 Mar 2006 02:01

Putative ChopClose added based on similarity with "1j95A" [LEE: 1, LME: 0, MR: 2, LG: 2, SS: 91.16, SI: 94.1176470588235, SO: 92.7272727272727]

Flow stage update by auto on 15 Mar 2006 01:01

NW result present for Chain "2a9hA"

Flow stage update by auto on 08 Mar 2006 14:25

All required files are present for Chain "2a9hA"

Flow stage update by auto on 08 Mar 2006 14:14

Beginning processing for Chain "2a9hA"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:13

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"