PDB Chain: 1yuiA

Molscript image for 1yuiA
1yuiA
PDB coordinates for chain 1yuiA

PDB 1yui, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1yuiA00 3.30.160.60 Molscript image for 1yuiA00

[top]
Domain boundaries for PDB chain 1yuiA

Chopping figure for chain 1yuiA
Domain IDStart ResStop Res NameLength
1yuiA00 10 63 54

[top]
Chain ATOM Sequence 

>pdb|1yuiA
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1yuiA
PKAKRAKHPPGTEKPRSRSQSEQPATCPICYAVIRQSRNLRRHLELRHFAKPGV
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 15:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:35

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"