Flow stage update by auto on 09 Mar 2006 23:36
Final ChopClose added based on similarity with "1yc6A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.59, SI: 100, SO: 100]
| Domain ID | CATH code | Image |
|---|---|---|
| 1yc6100 | 2.60.120.220 |
>pdb|1yc61 AAGQGKAIKAIAGYSISKWEASSDAITAKATNAMSITLPHELSSEKNKELKVGRVLLWLGLLPSVAGRIKACVAEKQAQA EAAFQVALAVADSSKEVVAAMYTDAFRGATLGDLLNLQIYLYASEAVPAKAVVVHLEVEHVRPTFDDFFTPVYR
Final ChopClose added based on similarity with "1yc6A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.59, SI: 100, SO: 100]
Final ChopClose added based on similarity with "1yc6A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.59, SI: 100, SO: 100]
Putative ChopClose added based on similarity with "1yc6A" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.59, SI: 100, SO: 100]
NW result present for Chain "1yc61"
All required files are present for Chain "1yc61"
Beginning processing for Chain "1yc61"
Chain passed the SIFT criteria
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"