PDB Chain: 1w85I

Molscript image for 1w85I
1w85I
PDB coordinates for chain 1w85I

PDB 1w85, Chain I

CATH Domains (1)

Domain IDCATH codeImage
1w85I00 4.10.320.10 Molscript image for 1w85I00

[top]
Domain boundaries for PDB chain 1w85I

Chopping figure for chain 1w85I
Domain IDStart ResStop Res NameLength
1w85I00 128 169 42

[top]
Chain ATOM Sequence 

>pdb|1w85I
RVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAG
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1w85I
AGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGA
BLAST against CATH

[top]
Chain History Events (9)

Property update by auto on 14 Jul 2006 15:16

Updated the chain's properties [modified "combs_md5_code" from "f67656f9721f9c6c2cc234f9193392bc" to "5eb93e244343c43be0fe3ec4c7130a6b"] [modified "seqres_md5_code" from "f67656f9721f9c6c2cc234f9193392bc" to "5eb93e244343c43be0fe3ec4c7130a6b"]

Flow stage update by auto on 09 Mar 2006 17:17

Final ChopClose added based on similarity with "1w4eA" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 92.77, SI: 95.7446808510638, SO: 95.9183673469388]

Chain chopped by auto on 09 Mar 2006 17:17

Final ChopClose added based on similarity with "1w4eA" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 92.77, SI: 95.7446808510638, SO: 95.9183673469388]

Chain chopping chopclose by auto on 09 Mar 2006 17:17

Putative ChopClose added based on similarity with "1w4eA" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 92.77, SI: 95.7446808510638, SO: 95.9183673469388]

Flow stage update by auto on 08 Mar 2006 14:27

NW result present for Chain "1w85I"

Flow stage update by auto on 08 Mar 2006 14:20

All required files are present for Chain "1w85I"

Flow stage update by auto on 08 Mar 2006 14:13

Beginning processing for Chain "1w85I"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:04

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"