PDB Chain: 1w85C

Molscript image for 1w85C
1w85C
PDB coordinates for chain 1w85C

PDB 1w85, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1w85C00 3.40.50.970 Molscript image for 1w85C00

[top]
Domain boundaries for PDB chain 1w85C

Chopping figure for chain 1w85C
Domain IDStart ResStop Res NameLength
1w85C00 4 368 365

[top]
Chain ATOM Sequence 

>pdb|1w85C
TFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAGQEA
SQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKMRGK
KAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLAVYA
AVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQAKE
EIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1w85C
GVKTFQFPFAEQLEKVAEQFPTFQILNEEGEVVNEEAMPELSDEQLKELMRRMVYTRILDQRSISLNRQGRLGFYAPTAG
QEASQIASHFALEKEDFILPGYRDVPQIIWHGLPLYQAFLFSRGHFHGNQIPEGVNVLPPQIIIGAQYIQAAGVALGLKM
RGKKAVAITYTGDGGTSQGDFYEGINFAGAFKAPAIFVVQNNRFAISTPVEKQTVAKTLAQKAVAAGIPGIQVDGMDPLA
VYAAVKAARERAINGEGPTLIETLCFRYGPHTMSGDDPTRYRSKELENEWAKKDPLVRFRKFLEAKGLWSEEEENNVIEQ
AKEEIKEAIKKADETPKQKVTDLISIMFEELPFNLKEQYEIYKEKESK
BLAST against CATH

[top]
Chain History Events (11)

Flow stage update by auto on 16 Oct 2006 06:28

Final ChopClose added based on similarity with "1w85A"

Chain chopped by auto on 16 Oct 2006 06:28

Final ChopClose added based on similarity with "1w85A"

Chain chopping chopclose by auto on 16 Oct 2006 06:28

Putative ChopClose added based on similarity with "1w85A"

Flow stage update by auto on 16 Oct 2006 06:16

No in_process hits for Chain "1w85C" ready to be processed

Update comment by auto on 16 Oct 2006 04:16

Chain "1w85C" hits Chain "1w85E" (100% over 100%) which is currently in process

Update comment by auto on 15 Oct 2006 21:17

Chain "1w85C" hits Chain "1w85G" (100% over 100%) which is currently in process

Flow stage update by auto on 09 Aug 2006 20:47

NW result present for Chain "1w85C"

Flow stage update by auto on 09 Aug 2006 20:41

All required files are present for Chain "1w85C"

Flow stage update by auto on 09 Aug 2006 20:36

Beginning processing for Chain "1w85C"

Flow stage update by auto on 09 Aug 2006 17:00

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:04

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"