PDB Chain: 1un6D

Molscript image for 1un6D
1un6D
PDB coordinates for chain 1un6D

PDB 1un6, Chain D

CATH Domains (2)

Domain IDCATH codeImage
1un6D01 3.30.160.60 Molscript image for 1un6D01
1un6D02 3.30.160.60 Molscript image for 1un6D02

[top]
Domain boundaries for PDB chain 1un6D

Chopping figure for chain 1un6D
Domain IDStart ResStop Res NameLength
1un6D01 133 159 27
1un6D02 160 190 31

[top]
Chain ATOM Sequence 

>pdb|1un6D
LPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1un6D
LPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 15:09

Updated the chain's properties [modified "seqres_md5_code" from "def87090582e9525a4a9108d184454ba" to "93748820be5842c1fc63625026c8a748"]

Flow stage update by auto on 06 Mar 2006 00:00

Cut based on decision in database "DomChop" on "cathdb"

Chain chopped by auto on 06 Mar 2006 00:00

Cut based on decision in database "DomChop" on "cathdb"

Flow stage update by auto on 05 Mar 2006 14:22

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 14:00

Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"