PDB Chain: 1tn3A

Molscript image for 1tn3A
1tn3A
PDB coordinates for chain 1tn3A

PDB 1tn3, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1tn3A00 3.10.100.10 Molscript image for 1tn3A00

[top]
Domain boundaries for PDB chain 1tn3A

Chopping figure for chain 1tn3A
Domain IDStart ResStop Res NameLength
1tn3A00 45 181 137

[top]
Chain ATOM Sequence 

>pdb|1tn3A
ALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWV
DMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1tn3A
ALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWV
DMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
BLAST against CATH

[top]
Chain History Events (5)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this chain was renamed from "1tn30" to "1tn3A" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Flow stage update by auto on 05 Mar 2006 15:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:13

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:32

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"