Property update by auto on 14 Jul 2006 14:54
Updated the chain's properties [modified "seqres_md5_code" from "7049c32814278f361f0bf7e356f41132" to "af54955d5a2f7cf61d96cf25bdded68b"]
| Domain ID | CATH code | Image |
|---|---|---|
| 1r3lC00 | 1.10.287.70 |
>pdb|1r3lC SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT SFGLVTAALATWFVGREQERRGH
Updated the chain's properties [modified "seqres_md5_code" from "7049c32814278f361f0bf7e356f41132" to "af54955d5a2f7cf61d96cf25bdded68b"]
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain passed the SIFT criteria
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"