PDB Chain: 1r3iC

Molscript image for 1r3iC
1r3iC
PDB coordinates for chain 1r3iC

PDB 1r3i, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1r3iC00 1.10.287.70 Molscript image for 1r3iC00

Domain boundaries for PDB chain 1r3iC

Chain ATOM Sequence

>pdb|1r3iC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH    

Chain COMBS Sequence

>pdb|1r3iC
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGIT
SFGLVTAALATWFVGREQERRGH    

Chain History Events (5)

Property update by auto on 14 Jul 2006 14:54

Updated the chain's properties [modified "seqres_md5_code" from "7049c32814278f361f0bf7e356f41132" to "af54955d5a2f7cf61d96cf25bdded68b"]

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:29

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"