PDB Chain: 1octC

Molscript image for 1octC
1octC
PDB coordinates for chain 1octC

PDB 1oct, Chain C

CATH Domains (2)

Domain IDCATH codeImage
1octC01 1.10.260.40 Molscript image for 1octC01
1octC02 1.10.10.60 Molscript image for 1octC02

[top]
Domain boundaries for PDB chain 1octC

Chopping figure for chain 1octC
Domain IDStart ResStop Res NameLength
1octC01 5 75 71
1octC02 102 161 60

[top]
Chain ATOM Sequence 

>pdb|1octC
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAERKKRTSIET
NIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1octC
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDSSLS
SPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 14:39

Updated the chain's properties [modified "combs_md5_code" from "4c0e0a54b5a6493184aacba9075284d4" to "d3e5119d77c50a4b4730ae34a3c2e20c"] [modified "seqres_md5_code" from "4c0e0a54b5a6493184aacba9075284d4" to "d3e5119d77c50a4b4730ae34a3c2e20c"]

Flow stage update by auto on 05 Mar 2006 17:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 17:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:23

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"