PDB Chain: 1nheC

Molscript image for 1nheC
1nheC
PDB coordinates for chain 1nheC

PDB 1nhe, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1nheC00 1.10.530.10 Molscript image for 1nheC00

[top]
Domain boundaries for PDB chain 1nheC

Chopping figure for chain 1nheC
Domain IDStart ResStop Res NameLength
1nheC00 1 123 123

[top]
Chain ATOM Sequence 

>pdb|1nheC
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKL
LDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1nheC
TELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAVVNDNGSTEYGLFQISDRFWCKSSEFPESENICGISCDKL
LDDELDDDIACAKKILAIKGIDYWKAYKPMCSEKLEQWRCEKP
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:22

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"