PDB Chain: 1my7A

Molscript image for 1my7A
1my7A
PDB coordinates for chain 1my7A

PDB 1my7, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1my7A00 2.60.40.10 Molscript image for 1my7A00

Domain boundaries for PDB chain 1my7A

Chain ATOM Sequence

>pdb|1my7A
TAELKICRVNRRSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSM
QLRRPSDRELSEPMEFQYLPDTDDRHR    

Chain COMBS Sequence

>pdb|1my7A
TAELKICRVNRRSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSM
QLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKR    

Chain History Events (5)

Property update by auto on 14 Jul 2006 14:30

Updated the chain's properties [modified "combs_md5_code" from "53c7da21020bacf16dbe8cdd0e238e4e" to "d56b75c7b6c85e5f6c9c86422cdb82a8"] [modified "seqres_md5_code" from "53c7da21020bacf16dbe8cdd0e238e4e" to "d56b75c7b6c85e5f6c9c86422cdb82a8"]

Flow stage update by auto on 05 Mar 2006 14:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:58

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:20

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"