Flow stage update by auto on 31 Aug 2007 18:09
Final ChopClose added based on similarity with "1srsA"
PDB Chain: 1mnmB
1mnmB
PDB 1mnm, Chain B
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 1mnmB01 | Not yet assigned |
Chain ATOM Sequence
>pdb|1mnmB RRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAP D
Chain History Events (14)
Chain chopped by auto on 31 Aug 2007 18:09
Final ChopClose added based on similarity with "1srsA"
Chain chopping chopclose by auto on 31 Aug 2007 18:09
Putative ChopClose added based on similarity with "1srsA"
Flow stage update by auto on 31 Aug 2007 18:07
No in_process hits for Chain "1mnmB" ready to be processed
Update comment by auto on 31 Aug 2007 17:57
Chain "1mnmB" hits Chain "1srsB" (66.2650602409639% over 88.0434782608696%) which is currently in process
Update comment by auto on 11 Aug 2007 10:02
Chain "1mnmB" hits Chain "1srsA" (66.2650602409639% over 88.0434782608696%) which is currently in process
Update comment by auto on 10 Aug 2007 17:40
Chain "1mnmB" hits Chain "1srsA" (66.2650602409639% over 88.0434782608696%) which is currently in process
Update comment by auto on 12 Jul 2007 20:51
Chain "1mnmB" hits Chain "1srsA" (66.2650602409639% over 88.0434782608696%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:38
Chain "1mnmB" hits Chain "1srsA" (66.2650602409639% over 88.0434782608696%) which is currently in process
Flow stage update by auto on 12 Jul 2007 20:30
NW result present for Chain "1mnmB"
Flow stage update by auto on 12 Jul 2007 20:05
All required files are present for Chain "1mnmB"
Flow stage update by auto on 12 Jul 2007 19:57
Beginning processing for Chain "1mnmB"
Flow stage update by auto on 23 Feb 2007 17:27
Chain passed the SIFT criteria
Insertion by auto on 05 Mar 2006 13:49
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"
