PDB Chain: 1mhnA

Molscript image for 1mhnA
1mhnA
PDB coordinates for chain 1mhnA

PDB 1mhn, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1mhnA00 2.30.30.140 Molscript image for 1mhnA00

[top]
Domain boundaries for PDB chain 1mhnA

Chopping figure for chain 1mhnA
Domain IDStart ResStop Res NameLength
1mhnA00 89 147 59

[top]
Chain ATOM Sequence 

>pdb|1mhnA
LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1mhnA
LQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICE
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:19

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"