PDB Chain: 1j95C

Molscript image for 1j95C
1j95C
PDB coordinates for chain 1j95C

PDB 1j95, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1j95C00 1.10.287.70 Molscript image for 1j95C00

[top]
Domain boundaries for PDB chain 1j95C

Chopping figure for chain 1j95C
Domain IDStart ResStop Res NameLength
1j95C00 24 121 98

[top]
Chain ATOM Sequence 

>pdb|1j95C
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSF
GLVTAALATWFVGREQER
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1j95C
LHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSF
GLVTAALATWFVGREQERRGHF
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 14:10

Updated the chain's properties [modified "combs_md5_code" from "d9749fc709beff1816bd877b78f1c821" to "02daedb94c36ae10a2a1011ba016cf6b"] [modified "seqres_md5_code" from "d9749fc709beff1816bd877b78f1c821" to "538a8490517a014c252a8a17b0dbc488"]

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:12

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"