PDB Chain: 1hddC

Molscript image for 1hddC
1hddC
PDB coordinates for chain 1hddC

PDB 1hdd, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1hddC00 1.10.10.60 Molscript image for 1hddC00

[top]
Domain boundaries for PDB chain 1hddC

Chopping figure for chain 1hddC
Domain IDStart ResStop Res NameLength
1hddC00 3 59 57

[top]
Chain ATOM Sequence 

>pdb|1hddC
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1hddC
MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 14:01

Updated the chain's properties [modified "combs_md5_code" from "f49808b6cc65d5d80523d40c9694cc79" to "8a9045612f367ec8e535be6506a47035"] [modified "seqres_md5_code" from "f49808b6cc65d5d80523d40c9694cc79" to "8a9045612f367ec8e535be6506a47035"]

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:09

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"