PDB Chain: 1gv2A

Molscript image for 1gv2A
1gv2A
PDB coordinates for chain 1gv2A

PDB 1gv2, Chain A

CATH Domains (2)

Domain IDCATH codeImage
1gv2A01 1.10.10.60 Molscript image for 1gv2A01
1gv2A02 1.10.10.60 Molscript image for 1gv2A02

Domain boundaries for PDB chain 1gv2A

Chain ATOM Sequence

>pdb|1gv2A
ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAE
IAKLLPGRTDNAIKNHWNSTMRR    

Chain COMBS Sequence

>pdb|1gv2A
ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAE
IAKLLPGRTDNAIKNHWNSTMRRKV    

Chain History Events (11)

Property update by auto on 01 Nov 2009 16:36

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.882352941176471" to "0.882687927107061"]

Property update by auto on 07 Nov 2007 23:22

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.882687927107061" to "0.882352941176471"]

Flow stage update by lewis on 18 Jan 2007 19:15

Rechopping chains just before release v3.1.0 in order to fix missing fragments.

Chain chopped by lewis on 18 Jan 2007 19:15

Rechopping chains just before release v3.1.0 in order to fix missing fragments.

Unchopped by lewis on 18 Jan 2007 19:15

Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.

Flow stage update by lewis on 18 Jan 2007 19:15

Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.

Property update by auto on 14 Jul 2006 13:58

Updated the chain's properties [modified "combs_md5_code" from "d3b1bbad1b39a810ef0dfa2735f9fc3b" to "28e3124a8ad977d979a8a8568c1c2920"] [modified "seqres_md5_code" from "d3b1bbad1b39a810ef0dfa2735f9fc3b" to "28e3124a8ad977d979a8a8568c1c2920"]

Flow stage update by auto on 05 Mar 2006 16:41

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:41

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:07

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"