Property update by auto on 01 Nov 2009 16:36
Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.882352941176471" to "0.882687927107061"]
| Domain ID | CATH code | Image |
|---|---|---|
| 1gv2A01 | 1.10.10.60 | |
| 1gv2A02 | 1.10.10.60 |
>pdb|1gv2A ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAE IAKLLPGRTDNAIKNHWNSTMRR
Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.882352941176471" to "0.882687927107061"]
Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.882687927107061" to "0.882352941176471"]
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.
Unchopping chains just before release v3.1.0 in order to fix missing fragments in their choppings.
Updated the chain's properties [modified "combs_md5_code" from "d3b1bbad1b39a810ef0dfa2735f9fc3b" to "28e3124a8ad977d979a8a8568c1c2920"] [modified "seqres_md5_code" from "d3b1bbad1b39a810ef0dfa2735f9fc3b" to "28e3124a8ad977d979a8a8568c1c2920"]
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain passed the SIFT criteria
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"