PDB Chain: 1gccA

Molscript image for 1gccA
1gccA
PDB coordinates for chain 1gccA

PDB 1gcc, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1gccA00 3.30.730.10 Molscript image for 1gccA00

[top]
Domain boundaries for PDB chain 1gccA

Chopping figure for chain 1gccA
Domain IDStart ResStop Res NameLength
1gccA00 144 206 63

[top]
Chain ATOM Sequence 

>pdb|1gccA
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1gccA
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLNFPLRV
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 15:31

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:31

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:06

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"