PDB Chain: 1fqtA

Molscript image for 1fqtA
1fqtA
PDB coordinates for chain 1fqtA

PDB 1fqt, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1fqtA00 2.102.10.10 Molscript image for 1fqtA00

Domain boundaries for PDB chain 1fqtA

Chain ATOM Sequence

>pdb|1fqtA
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDVVECSLHMGKFCVRTGKVKSP
PPCEALKIFPIRIEDNDVLVDFEAGYLAP    

Chain COMBS Sequence

>pdb|1fqtA
GSHMKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDVVECSLHMGKFCVRTGKV
KSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP    

Chain History Events (5)

Property update by auto on 14 Jul 2006 13:52

Updated the chain's properties [modified "combs_md5_code" from "71c82051091de8b18ce78ee6ed824f8a" to "9ad71f74a835d373c1ea4285c6be98a8"] [modified "seqres_md5_code" from "71c82051091de8b18ce78ee6ed824f8a" to "9ad71f74a835d373c1ea4285c6be98a8"]

Flow stage update by auto on 05 Mar 2006 15:10

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:10

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:40

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:05

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"