Flow stage update by cuff on 21 Dec 2006 17:29
checked choppings
PDB Chain: 1ewqA
1ewqA
PDB 1ewq, Chain A
CATH Domains (5)
| Domain ID | CATH code | Image |
|---|---|---|
| 1ewqA01 | 3.40.1170.10 | |
| 1ewqA02 | 3.30.420.110 | |
| 1ewqA03 | 1.10.1420.10 | |
| 1ewqA04 | Not yet assigned | |
| 1ewqA05 | 3.40.50.300 |
Chain ATOM Sequence
>pdb|1ewqA EGLKGEGPGPLPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPAGIPLRAFEAYAE RLLKGFRLAVADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLPREANYLAAIATGDGWGLAFLDVSTGEFKGTVLKSKS ALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVLSEAPFEPEGEGPLALRRARGALLAYAQRTQGGALSLQPFRFYD PGAFRLPEATLRALEVFEPLRGQDTLFSVLDETRTAPGRRLLQSWLRHPLLDRGPLEARLDRVEGFVREGALREGVRRLL YRLADLERLATRLELGRASPKDLGALRRSLQILPELRALLGEEVGLPDLSPLKEELEAALVEDPPLKVSEGGLIREGYDP DLDALRAAHREGVAYFLELEERERERTGIPTLKVGYNAVFGYYLEVTRPYYERVPKEYRPVQTLKDRQRYTLPEKEKERE VYRLEALIRRREEEVFLEVRERAKRQAEALREAARILAELDVYAALAEVAVRYGYVRPRFGDRLQIRAGRHPVVERRTEF VPNDLEAHELVLITGPNAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIGAGKSTFVEEEVALILKEATENS LVLLDEVGRGTSSLDGVAIATAVAEALHERRAYTLFATHYFELTALGLPRLKNLHVAAREEAGGLVFYHQVLPGPASKSY GVEVAAAGLPKEVVARARALLQAAAR
Chain COMBS Sequence
>pdb|1ewqA XEGXLKGEGPGPLPPLLQQYVELRDQYPDYLLLFQVGDFYECFGEDAERLARALGLVLTHKTSKDFTTPXAGIPLRAFEA YAERLLKXGFRLAVADQVEPAEEAEGLVRREVTQLLTPGTLLQESLLPREANYLAAIATGDGWGLAFLDVSTGEFKGTVL KSKSALYDELFRHRPAEVLLAPELLENGAFLDEFRKRFPVXLSEAPFEPEGEGPLALRRARGALLAYAQRTQGGALSLQP FRFYDPGAFXRLPEATLRALEVFEPLRGQDTLFSVLDETRTAPGRRLLQSWLRHPLLDRGPLEARLDRVEGFVREGALRE GVRRLLYRLADLERLATRLELGRASPKDLGALRRSLQILPELRALLGEEVGLPDLSPLKEELEAALVEDPPLKVSEGGLI REGYDPDLDALRAAHREGVAYFLELEERERERTGIPTLKVGYNAVFGYYLEVTRPYYERVPKEYRPVQTLKDRQRYTLPE XKEKEREVYRLEALIRRREEEVFLEVRERAKRQAEALREAARILAELDVYAALAEVAVRYGYVRPRFGDRLQIRAGRHPV VERRTEFVPNDLEXAHELVLITGPNXAGKSTFLRQTALIALLAQVGSFVPAEEAHLPLFDGIYTRIGASDDLAGGKSTFX VEXEEVALILKEATENSLVLLDEVGRGTSSLDGVAIATAVAEALHERRAYTLFATHYFELTALGLPRLKNLHVAAREEAG GLVFYHQVLPGPASKSYGVEVAAXAGLPKEVVARARALLQAXAAR
Chain History Events (65)
Chain chopped by cuff on 21 Dec 2006 17:29
checked choppings
Domchop review by cuff on 19 Dec 2006 18:08
fine
Flow stage update by cuff on 19 Dec 2006 18:08
fine
Chain chopping manual by cuff on 19 Dec 2006 18:08
fine
Domchop return by cuff on 19 Dec 2006 17:56
tweak boundary
Flow stage update by cuff on 19 Dec 2006 17:56
tweak boundary
Domchop comment by lewis on 12 Sep 2006 19:35
I think that this chain was unchopped due to the following entries:
1ewqA04[in old HomCheck under some problem state]
Domchop review by addou on 02 Sep 2006 18:54
Sending chopping (event 563492) for review
Flow stage update by addou on 02 Sep 2006 18:54
Sending chopping (event 563492) for review
Chain chopping manual by addou on 02 Sep 2006 18:51
Sarah - Cathedral got three domains right - manually adjusted the two remaining domains
Domchop allotment by addou on 02 Sep 2006 18:11
User 'addou' has allocated a chain to themselves for DomChopping
Flow stage update by addou on 02 Sep 2006 18:11
User 'addou' has allocated a chain to themselves for DomChopping
Flow stage update by auto on 19 Aug 2006 01:07
Retrieved results for job ID j081823071.16985 and chopping inserted.
Chain chopping hmm by auto on 19 Aug 2006 01:07
Chain HMM chopping
Update comment by auto on 18 Aug 2006 23:07
Job j081823071.16985 is not yet finished.
Flow stage update by auto on 18 Aug 2006 23:06
The chain has been submitted to the chain HMM webservice.
Hmm submit by auto on 18 Aug 2006 23:06
The chain has been submitted to the chain HMM webservice.
Flow stage update by auto on 18 Aug 2006 23:05
Retrieved results for job ID b081814421.602 and chopping inserted.
Chain chopping cathedral by auto on 18 Aug 2006 23:05
Chain CATHEDRAL chopping from job b081814421.602
Update comment by auto on 18 Aug 2006 21:06
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 19:50
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 17:03
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 16:41
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 16:14
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 15:50
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 15:35
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 15:27
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 15:20
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 14:54
Job b081814421.602 is not yet finished.
Update comment by auto on 18 Aug 2006 14:45
Job b081814421.602 is not yet finished.
Flow stage update by auto on 18 Aug 2006 14:41
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 14:40
The chain has been submitted to the chain CATHEDRAL webservice.
Update comment by auto on 18 Aug 2006 14:33
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 13:36
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 13:16
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 12:25
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 12:22
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 12:10
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 11:34
Job a081811094.30609 is not yet finished.
Update comment by auto on 18 Aug 2006 11:12
Job a081811094.30609 is not yet finished.
Flow stage update by auto on 18 Aug 2006 11:08
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 11:08
The chain has been submitted to the chain CATHEDRAL webservice.
Update comment by auto on 18 Aug 2006 10:38
Job b081810122.29046 is not yet finished.
Update comment by auto on 18 Aug 2006 10:17
Job b081810122.29046 is not yet finished.
Flow stage update by auto on 18 Aug 2006 10:11
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 10:11
The chain has been submitted to the chain CATHEDRAL webservice.
Flow stage update by auto on 18 Aug 2006 09:59
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "1ewqA"
Chain chopping puu by auto on 18 Aug 2006 09:59
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Chain chopping detective by auto on 18 Aug 2006 09:59
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping domak by auto on 18 Aug 2006 09:59
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 18 Aug 2006 09:33
Number of chains in ballcock flow stages is 44 which is less than the max allowed of 70
Flow stage update by auto on 18 Aug 2006 09:30
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 18 Aug 2006 09:29
Putative ChopClose added based on similarity with "1ewrA"
Flow stage update by auto on 18 Aug 2006 08:33
No in_process hits for Chain "1ewqA" ready to be processed
Flow stage update by auto on 09 Aug 2006 20:46
NW result present for Chain "1ewqA"
Flow stage update by auto on 09 Aug 2006 20:38
All required files are present for Chain "1ewqA"
Flow stage update by auto on 09 Aug 2006 20:35
Beginning processing for Chain "1ewqA"
Unchopped by sillitoe on 08 Aug 2006 22:32
Pulling a group of chains before we begin DomChopping for CATH v3.1.0 (as described in ticket:92)
Flow stage update by sillitoe on 08 Aug 2006 22:32
Pulling a group of chains before we begin DomChopping for CATH v3.1.0 (as described in ticket:92)
Property update by auto on 14 Jul 2006 13:48
Updated the chain's properties [modified "combs_md5_code" from "47fa1667b35c6aeec337a5cf711f391d" to "9007d63131ce9b28f8cebb622d43676a"] [modified "seqres_md5_code" from "47fa1667b35c6aeec337a5cf711f391d" to "9007d63131ce9b28f8cebb622d43676a"]
Flow stage update by auto on 05 Mar 2006 16:29
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain chopped by auto on 05 Mar 2006 16:29
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Flow stage update by auto on 05 Mar 2006 13:40
Chain passed the SIFT criteria
Insertion by auto on 05 Mar 2006 13:03
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
