PDB Chain: 1brcI

Molscript image for 1brcI
1brcI
PDB coordinates for chain 1brcI

PDB 1brc, Chain I

CATH Domains (1)

Domain IDCATH codeImage
1brcI00 4.10.410.10 Molscript image for 1brcI00

[top]
Domain boundaries for PDB chain 1brcI

Chopping figure for chain 1brcI
Domain IDStart ResStop Res NameLength
1brcI00 1 56 56

[top]
Chain ATOM Sequence 

>pdb|1brcI
VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1brcI
VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:57

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"