PDB Chain: 1bl8D

Molscript image for 1bl8D
1bl8D
PDB coordinates for chain 1bl8D

PDB 1bl8, Chain D

CATH Domains (1)

Domain IDCATH codeImage
1bl8D00 1.10.287.70 Molscript image for 1bl8D00

[top]
Domain boundaries for PDB chain 1bl8D

Chopping figure for chain 1bl8D
Domain IDStart ResStop Res NameLength
1bl8D00 23 119 97

[top]
Chain ATOM Sequence 

>pdb|1bl8D
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
FGLVTAALATWFVGREQ
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1bl8D
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITS
FGLVTAALATWFVGREQ
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:57

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"