PDB Chain: 1b3tA

Molscript image for 1b3tA
1b3tA
PDB coordinates for chain 1b3tA

PDB 1b3t, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1b3tA00 3.30.70.390 Molscript image for 1b3tA00

[top]
Domain boundaries for PDB chain 1b3tA

Chopping figure for chain 1b3tA
Domain IDStart ResStop Res NameLength
1b3tA00 461 607 147

[top]
Chain ATOM Sequence 

>pdb|1b3tA
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLP
FGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1b3tA
KGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLP
FGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLP
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 15:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 15:27

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:39

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 12:56

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"