PDB Chain: 3croL

Molscript image for 3croL
3croL
PDB coordinates for chain 3croL

PDB 3cro, Chain L

CATH Domains (1)

Domain IDCATH codeImage
3croL00 1.10.260.40 Molscript image for 3croL00

[top]
Domain boundaries for PDB chain 3croL

Chopping figure for chain 3croL
Domain IDStart ResStop Res NameLength
3croL00 -1 64 66

[top]
Chain ATOM Sequence 

>pdb|3croL
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTK
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|3croL
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEIAMALNCDPVWLQYGTKRGKAA
BLAST against CATH

[top]
Chain History Events (7)

Property update by auto on 24 Nov 2006 16:54

Updated the chain's properties [modified "atom_md5_code" from "" to "f92d50fbc683d9a8835998d9303f38fd"] [modified "combs_md5_code" from "" to "72f3a5b6a784c146500ed75b28076a8e"] [modified "seqres_md5_code" from "" to "72f3a5b6a784c146500ed75b28076a8e"] [modified "seq_length" from undef to "66"]

Property update by auto on 23 Nov 2006 15:53

Updated the chain's properties [modified "atom_md5_code" from "f92d50fbc683d9a8835998d9303f38fd" to ""] [modified "combs_md5_code" from "72f3a5b6a784c146500ed75b28076a8e" to ""] [modified "seqres_md5_code" from "72f3a5b6a784c146500ed75b28076a8e" to ""] [modified "seq_length" from "66" to undef]

Property update by auto on 14 Jul 2006 15:47

Updated the chain's properties [modified "combs_md5_code" from "f92d50fbc683d9a8835998d9303f38fd" to "72f3a5b6a784c146500ed75b28076a8e"] [modified "seqres_md5_code" from "f92d50fbc683d9a8835998d9303f38fd" to "72f3a5b6a784c146500ed75b28076a8e"]

Flow stage update by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:26

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:37

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"