PDB Chain: 2hdcA

Molscript image for 2hdcA
2hdcA
PDB coordinates for chain 2hdcA

PDB 2hdc, Chain A

CATH Domains (1)

Domain IDCATH codeImage
2hdcA00 1.10.10.10 Molscript image for 2hdcA00

[top]
Domain boundaries for PDB chain 2hdcA

Chopping figure for chain 2hdcA
Domain IDStart ResStop Res NameLength
2hdcA00 2 98 97

[top]
Chain ATOM Sequence 

>pdb|2hdcA
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDP
QSEDMFDNGSFLRRRKR
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|2hdcA
VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDP
QSEDMFDNGSFLRRRKR
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:36

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"