PDB Chain: 1ysaC

Molscript image for 1ysaC
1ysaC
PDB coordinates for chain 1ysaC

PDB 1ysa, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1ysaC00 3.30.160.60 Molscript image for 1ysaC00

[top]
Domain boundaries for PDB chain 1ysaC

Chopping figure for chain 1ysaC
Domain IDStart ResStop Res NameLength
1ysaC00 225 281 57

[top]
Chain ATOM Sequence 

>pdb|1ysaC
KDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1ysaC
MKDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
BLAST against CATH

[top]
Chain History Events (6)

Property update by auto on 08 Nov 2007 01:37

Updated the chain's properties [modified "combs_md5_code" from "3a52935982a15d1318ca1d40357bedb7" to "8b18ef4d997839a9e638f77e2390c687"] [modified "seqres_md5_code" from "3a52935982a15d1318ca1d40357bedb7" to "8b18ef4d997839a9e638f77e2390c687"]

Property update by auto on 14 Jul 2006 15:28

Updated the chain's properties [modified "combs_md5_code" from "8e493bc6fdffd55723405aa964644bac" to "3a52935982a15d1318ca1d40357bedb7"] [modified "seqres_md5_code" from "8e493bc6fdffd55723405aa964644bac" to "3a52935982a15d1318ca1d40357bedb7"]

Flow stage update by auto on 05 Mar 2006 14:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:39

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:35

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"