PDB Chain: 1yrnA

Molscript image for 1yrnA
1yrnA
PDB coordinates for chain 1yrnA

PDB 1yrn, Chain A

CATH Domains (1)

Domain IDCATH codeImage
1yrnA00 1.10.10.60 Molscript image for 1yrnA00

[top]
Domain boundaries for PDB chain 1yrnA

Chopping figure for chain 1yrnA
Domain IDStart ResStop Res NameLength
1yrnA00 77 125 49

[top]
Chain ATOM Sequence 

>pdb|1yrnA
ISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1yrnA
KKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK
BLAST against CATH

[top]
Chain History Events (6)

Property update by auto on 08 Nov 2007 01:37

Updated the chain's properties [modified "frac_not_alpha_carbon" from "0.875634517766497" to "0.875318066157761"]

Property update by auto on 14 Jul 2006 15:28

Updated the chain's properties [modified "combs_md5_code" from "165e2f64ba48b64adbc9775cbac522ac" to "150d30807de0dd6bc40cca0e1c753ccf"] [modified "seqres_md5_code" from "165e2f64ba48b64adbc9775cbac522ac" to "150d30807de0dd6bc40cca0e1c753ccf"]

Flow stage update by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:35

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"