PDB Chain: 1ubdC

Molscript image for 1ubdC
1ubdC
PDB coordinates for chain 1ubdC

PDB 1ubd, Chain C

CATH Domains (4)

Domain IDCATH codeImage
1ubdC01 3.30.160.60 Molscript image for 1ubdC01
1ubdC02 3.30.160.60 Molscript image for 1ubdC02
1ubdC03 3.30.160.60 Molscript image for 1ubdC03
1ubdC04 3.30.160.60 Molscript image for 1ubdC04

[top]
Domain boundaries for PDB chain 1ubdC

Chopping figure for chain 1ubdC
Domain IDStart ResStop Res NameLength
1ubdC01 295 322 28
1ubdC02 323 349 27
1ubdC03 350 379 30
1ubdC04 380 408 29

[top]
Chain ATOM Sequence 

>pdb|1ubdC
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHV
RIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHA
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1ubdC
MEPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNL
RTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
BLAST against CATH

[top]
Chain History Events (5)

Property update by auto on 14 Jul 2006 15:08

Updated the chain's properties [modified "combs_md5_code" from "119710610fc9a413d05a0655844ea6d8" to "834fa664afa21d08afd49854a964b165"] [modified "seqres_md5_code" from "119710610fc9a413d05a0655844ea6d8" to "834fa664afa21d08afd49854a964b165"]

Flow stage update by auto on 05 Mar 2006 17:47

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 17:47

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:33

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"