PDB Chain: 1tc3C

Molscript image for 1tc3C
1tc3C
PDB coordinates for chain 1tc3C

PDB 1tc3, Chain C

CATH Domains (1)

Domain IDCATH codeImage
1tc3C00 1.10.10.60 Molscript image for 1tc3C00

[top]
Domain boundaries for PDB chain 1tc3C

Chopping figure for chain 1tc3C
Domain IDStart ResStop Res NameLength
1tc3C00 202 252 51

[top]
Chain ATOM Sequence 

>pdb|1tc3C
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
BLAST against CATH

[top]
Chain COMBS Sequence 

>pdb|1tc3C
PRGSALSDTERAQLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDPVSYGTS
BLAST against CATH

[top]
Chain History Events (4)

Flow stage update by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Chain chopped by auto on 05 Mar 2006 14:24

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"

Flow stage update by auto on 05 Mar 2006 13:41

Chain passed the SIFT criteria

Insertion by auto on 05 Mar 2006 13:32

This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"