Flow stage update by cuff on 13 Dec 2006 16:18
nice batch of choppings
PDB Chain: 1svcP
1svcP
PDB 1svc, Chain P
CATH Domains (2)
| Domain ID | CATH code | Image |
|---|---|---|
| 1svcP01 | 2.60.40.340 | |
| 1svcP02 | 2.60.40.10 |
Chain ATOM Sequence
>pdb|1svcP PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAAL QQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQ IRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPE
Chain COMBS Sequence
>pdb|1svcP PYLQILEQPKQRGFRFRYVAEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAAL QQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQ IRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQR KRQK
Chain History Events (54)
Chain chopped by cuff on 13 Dec 2006 16:18
nice batch of choppings
Domchop review by cuff on 19 Sep 2006 13:59
original chopping reviewed and corrected according to comments in homcheck (old pages) and also HMM/CATHEDRAL scores.
Flow stage update by cuff on 19 Sep 2006 13:59
original chopping reviewed and corrected according to comments in homcheck (old pages) and also HMM/CATHEDRAL scores.
Domchop allotment by cuff on 19 Sep 2006 13:37
User 'cuff' has allocated a chain to themselves for DomChopping
Flow stage update by cuff on 19 Sep 2006 13:37
User 'cuff' has allocated a chain to themselves for DomChopping
Domchop comment by lewis on 12 Sep 2006 19:35
I think that this chain was unchopped due to the following entries:
1gjiA02[in old HomCheck under some problem state]
Flow stage update by auto on 18 Aug 2006 17:06
Retrieved results for job ID h081815291.10034 and chopping inserted.
Chain chopping hmm by auto on 18 Aug 2006 17:06
Chain HMM chopping
Update comment by auto on 18 Aug 2006 16:43
Job h081815291.10034 is not yet finished.
Update comment by auto on 18 Aug 2006 16:17
Job h081815291.10034 is not yet finished.
Update comment by auto on 18 Aug 2006 15:53
Job h081815291.10034 is not yet finished.
Update comment by auto on 18 Aug 2006 15:37
Job h081815291.10034 is not yet finished.
Update comment by auto on 18 Aug 2006 15:28
Job h081815291.10034 is not yet finished.
Flow stage update by auto on 18 Aug 2006 15:28
The chain has been submitted to the chain HMM webservice.
Hmm submit by auto on 18 Aug 2006 15:28
The chain has been submitted to the chain HMM webservice.
Flow stage update by auto on 18 Aug 2006 15:25
Retrieved results for job ID i081814381.394 and chopping inserted.
Chain chopping cathedral by auto on 18 Aug 2006 15:25
Chain CATHEDRAL chopping from job i081814381.394
Update comment by auto on 18 Aug 2006 15:19
Job i081814381.394 is not yet finished.
Update comment by auto on 18 Aug 2006 14:52
Job i081814381.394 is not yet finished.
Update comment by auto on 18 Aug 2006 14:43
Job i081814381.394 is not yet finished.
Flow stage update by auto on 18 Aug 2006 14:37
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 14:37
The chain has been submitted to the chain CATHEDRAL webservice.
Update comment by auto on 18 Aug 2006 14:31
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 13:35
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 13:14
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 12:24
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 12:21
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 12:08
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 11:33
Job d081811061.30375 is not yet finished.
Update comment by auto on 18 Aug 2006 11:10
Job d081811061.30375 is not yet finished.
Flow stage update by auto on 18 Aug 2006 11:05
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 11:04
The chain has been submitted to the chain CATHEDRAL webservice.
Update comment by auto on 18 Aug 2006 10:37
Job c081810081.28801 is not yet finished.
Update comment by auto on 18 Aug 2006 10:15
Job c081810081.28801 is not yet finished.
Flow stage update by auto on 18 Aug 2006 10:07
The chain has been submitted to the chain CATHEDRAL webservice.
Cathedral submit by auto on 18 Aug 2006 10:06
The chain has been submitted to the chain CATHEDRAL webservice.
Flow stage update by auto on 18 Aug 2006 09:36
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DETECTIVE, CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "1svcP"
Chain chopping puu by auto on 18 Aug 2006 09:36
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Chain chopping detective by auto on 18 Aug 2006 09:36
Chopping proposed by the "CHAIN_CHOPPING_DETECTIVE" algorithm
Chain chopping domak by auto on 18 Aug 2006 09:36
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 18 Aug 2006 09:33
Number of chains in ballcock flow stages is 10 which is less than the max allowed of 70
Flow stage update by auto on 18 Aug 2006 08:34
No ChopClose result provided for Chain "1svcP"
Flow stage update by auto on 18 Aug 2006 08:33
No in_process hits for Chain "1svcP" ready to be processed
Flow stage update by auto on 09 Aug 2006 20:46
NW result present for Chain "1svcP"
Flow stage update by auto on 09 Aug 2006 20:38
All required files are present for Chain "1svcP"
Flow stage update by auto on 09 Aug 2006 20:35
Beginning processing for Chain "1svcP"
Unchopped by sillitoe on 08 Aug 2006 22:32
Pulling a group of chains before we begin DomChopping for CATH v3.1.0 (as described in ticket:92)
Flow stage update by sillitoe on 08 Aug 2006 22:32
Pulling a group of chains before we begin DomChopping for CATH v3.1.0 (as described in ticket:92)
Property update by auto on 14 Jul 2006 15:02
Updated the chain's properties [modified "combs_md5_code" from "42f0e2e1ab73e6d3c0ec194ecd3c66db" to "e8f663ff213bf13e537bef92d229355f"] [modified "seqres_md5_code" from "42f0e2e1ab73e6d3c0ec194ecd3c66db" to "252d4faff11629b072558a062d8593a5"]
Flow stage update by auto on 05 Mar 2006 17:44
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Chain chopped by auto on 05 Mar 2006 17:44
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
Flow stage update by auto on 05 Mar 2006 13:41
Chain passed the SIFT criteria
Insertion by auto on 05 Mar 2006 13:31
This chain was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
