Flow stage update by cuff on 31 Aug 2007 15:25
nice chopping
PDB Chain: 1srsA
1srsA
PDB 1srs, Chain A
CATH Domains (1)
| Domain ID | CATH code | Image |
|---|---|---|
| 1srsA01 | Not yet assigned |
Chain ATOM Sequence
>pdb|1srsA TRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCL NSPD
Chain History Events (30)
Chain chopped by cuff on 31 Aug 2007 15:25
nice chopping
Chain chopping manual by tronnberg on 16 Jul 2007 11:00
WCD (?)
Domchop review by tronnberg on 16 Jul 2007 11:00
WCD (?)
Flow stage update by tronnberg on 16 Jul 2007 11:00
WCD (?)
Domchop allotment by tronnberg on 16 Jul 2007 10:56
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by tronnberg on 16 Jul 2007 10:56
User 'tronnberg' has allocated a chain to themselves for DomChopping with comment : Grabbed this chain via DomChop's "Get Me A Chain" button.
Flow stage update by lewis on 15 Jul 2007 21:41
The HMM(SAM) scan for 1srsA returned no results and this doesn't appear to be an error so I am shifting 1srsA on to DOMCHOP_READY
Update comment by auto on 14 Jul 2007 12:19
HMM(SAM) job SID3191997013130800 for entry "1srsA" returned no results. In an ideal world, all HMM(SAM) scans would return results. This isn't an ideal world and we're all going to have to deal with that. You need to decide why this HMM(SAM) scan has returned no results. Is it because there are no good HMM hits or is it because something has gone wrong? SG structures are more likely to have no decent HMM(SAM) hits than normal structures.
If something has gone wrong, please track down the problem and fix it.
If you are happy that there is no problem, then you may wish to run a command like the following one:
/usr/local/svn/source/update/v3.1.1/utilities/UpdateFlowStage.pl -d cathdb_current -h fletcher -u
Update comment by auto on 14 Jul 2007 05:59
HMM(SAM) job SID3191997013130800 is not yet finished.
Flow stage update by auto on 14 Jul 2007 05:55
The entry "1srsA" has been submitted to the HMM (SAM) webservice.
Hmm submit by auto on 14 Jul 2007 05:55
The entry "1srsA" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 14 Jul 2007 05:28
Retrieved "1srsA" CATHEDRAL results for job ID SID7223344247758992 and inserted them into the database.
Chain chopping cathedral by auto on 14 Jul 2007 05:28
Chain "1srsA" CATHEDRAL chopping from job SID7223344247758992
Flow stage update by auto on 14 Jul 2007 01:33
The entry "1srsA" has been submitted to the CATHEDRAL webservice.
Cathedral submit by auto on 14 Jul 2007 01:33
The entry "1srsA" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 13 Jul 2007 23:52
ScanList with 9336 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1srsA.scanlist" for "1srsA"
Update comment by auto on 13 Jul 2007 18:32
Waiting for 2347 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.
Chain chopping puu by auto on 13 Jul 2007 16:34
Chopping proposed by the "CHAIN_CHOPPING_PUU" algorithm
Flow stage update by auto on 13 Jul 2007 16:34
Added putative Choppings from the DBS that ran (CHAIN_CHOPPING_DOMAK, CHAIN_CHOPPING_PUU) for Chain "1srsA"
Chain chopping domak by auto on 13 Jul 2007 16:34
Chopping proposed by the "CHAIN_CHOPPING_DOMAK" algorithm
Flow stage update by auto on 13 Jul 2007 16:10
Number of chains in ballcock flow stages is 126 which is less than the max allowed of 400
Flow stage update by auto on 12 Jul 2007 21:01
ChopClose result is not good enough for automatic chopping
Chain chopping chopclose by auto on 12 Jul 2007 21:01
Putative ChopClose added based on similarity with "1jw2A"
Flow stage update by auto on 12 Jul 2007 20:38
No in_process hits for Chain "1srsA" ready to be processed
Flow stage update by auto on 12 Jul 2007 20:30
NW result present for Chain "1srsA"
Flow stage update by auto on 12 Jul 2007 20:05
All required files are present for Chain "1srsA"
Flow stage update by auto on 12 Jul 2007 19:57
Beginning processing for Chain "1srsA"
Flow stage update by auto on 23 Feb 2007 17:27
Chain passed the SIFT criteria
Insertion by auto on 05 Mar 2006 13:57
Adding chain from chain pdb dir "/cath/data/cathv3/chainpdb"
